KEGG   Acinetobacter baumannii ACICU: ACICU_02766Help
Entry
ACICU_02766       CDS       T00710                                 

Definition
(GenBank) essential recombination function protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2927561..2928595
Genome map
AA seq 344 aa AA seqDB search
MNAAINPDVLGNATTVNPLDLPGLEQVFHHPTFIKVVNELKAPKSHTNEFGGGYKYRSAE
DIQEALKPLLVKYKCTVITRKFDTADGFEIYAYMVFKDQKYIRCDVPGEAKYDFDRDLNS
NKKVSKTQQYASYQSYAKKYALGNLLMIDDSQNDLDTHTNNNIKNERQRDNTQKYQNQSN
NGYVATKADCDKALKQIKDLPLDTPLTQASYFFDGIRNQLPEFDEILFAACNEKYLVIQQ
HLESLSQKQQEAVQSNGTAQQQKQQAQQQRGNTTQAQNPPNAPKTGCISNKQRDQLQAFI
DERGLDVKYVCEFLGIDTLADIQAEKIELAKAEIDKLAKQEIKA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgcaattaatcccgatgtattaggtaatgctacaactgtaaatcctcttgac
ttacctggtcttgaacaagtttttcatcatccaacttttattaaagttgttaatgagctt
aaggctccaaagtctcatacaaatgaatttggtggtggctataaatatcgctctgctgag
gatattcaagaagcattaaagccacttcttgtgaagtacaaatgtactgttattactaga
aaatttgataccgctgatggttttgaaatttatgcatacatggtattcaaagaccagaaa
tatattcgttgtgatgttcctggtgaagctaaatatgattttgatcgtgacctaaatagc
aataaaaaggtctctaaaactcaacaatatgcttcttatcagagctatgcaaaaaaatat
gctcttggcaatttgttaatgattgatgattcgcagaatgacctagatacacacacgaat
aacaatattaaaaacgagcgtcaacgcgacaatactcagaaataccaaaaccaatcaaat
aacggttatgtggccacaaaagctgactgtgataaggcgcttaaacaaatcaaagatttg
ccattagacacgcctttaactcaggcatcttatttctttgatggtattcgcaatcaactt
cctgagtttgatgaaattctttttgctgcatgcaatgaaaagtatttggtgattcaacag
catttagaaagtttgagtcagaaacaacaagaagcggttcaatctaatggtactgctcag
caacaaaaacagcaggctcaacaacaacgtggcaacaccacccaagcccaaaatccacca
aacgcacctaaaactggttgtatctcaaataagcaacgcgaccagctgcaggcgtttatt
gatgagcgcggtctagacgttaagtatgtctgtgaatttctaggtatcgacaccttggca
gatattcaagctgaaaaaatagaactggccaaagcagaaattgacaaactggcgaaacag
gaaattaaagcatga

DBGET integrated database retrieval system