KEGG   Acinetobacter baumannii ACICU: ACICU_02767Help
Entry
ACICU_02767       CDS       T00710                                 

Definition
(GenBank) DNA polymerase III, epsilon subunit
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2928592..2929221
Genome map
AA seq 209 aa AA seqDB search
MSALILDTETSDFEKFPIEIAHVPVSFLDSGELFVDKDACFDEYFSCPEPISFGAMAVHH
ILETDIADKPSYETFRLPKDVQYIIGHNVDYDLRAIKLADKSVNAKSICTLALSRLVWPD
AAHNLSALIYMLSNGSVKARESIRNAHNAKQDVLLTAVLLKQICKALGIKDMQSLFLFSE
QARIPKKLLSASIKVWTLKTYLLITSPGY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattaattttagatactgaaacctcagatttcgagaagtttccaattgagatc
gctcatgtaccggttagctttcttgatagcggtgaattgtttgttgataaagatgcttgt
tttgatgagtacttctcatgccctgagccgatcagtttcggggccatggcggtacatcac
attctagaaacagatatagcagacaagcctagctatgaaacattccgcttgcctaaggat
gttcaatacatcattggccacaatgttgattatgacctgagagctatcaagcttgctgac
aagtccgtaaatgcaaaatcaatttgcacgttagccttgtctcgccttgtctggccagat
gcagctcataatctttcggcactcatttacatgctgtcaaatggctcagtaaaagcccga
gaatctattcgtaatgctcataacgcgaagcaggatgttttgttaactgcagtattgctc
aagcaaatttgcaaagctttaggcatcaaagatatgcaatcgctgttcttgttttcagag
caagcacgcatcccaaaaaaattactttcggcaagcataaaggtatggacattaaagact
tacctgctgattacgtcacctggttattaa

DBGET integrated database retrieval system