KEGG   Acinetobacter baumannii ACICU: ACICU_02768Help
Entry
ACICU_02768       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2929276..2930628
Genome map
AA seq 450 aa AA seqDB search
MNILNNVEAFAALQSGKNLLCRHIEGEFAELNEFPATVFGNPEYQFCIDIEKIELAGFTF
TKPCTLDELVDEQKVFWVDFSKSTIIAGDFSSKNTYLVTLVNNGVVQRDFENAQLFLKGF
QAFVGINQEITLTTCDPIFNDANEDEDLSTETKSVKSKGKKKTKEVSADPQLLETEKDII
LDGISSSKTECEIDSLCFGLEKHSFTPDQLKAIEDAKNTKLAELAEIKSKAEDEKHDLLN
LAEAKTQDPELSVLCEAFIDEISNSKSKEDLDFIRARINSNGVLTEVENAELNTRLNIKA
KSFEKVDVYVNVPDASQNNGKKYIEEEEGKYQKKLAELKKRVDESKTVTEVNAVTKYTNS
WSAEQRAPLLQYMHKRLEELKKEKQANEPSLLVKIQNAPDLATLDAYEIDIHSLDPLAQP
KMMQAVTARKLELEKPNTSSSIYLIDEDLP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttaaataatgttgaagcttttgcagctttgcaaagcggtaaaaatttactt
tgtcgccatattgagggcgaatttgcagagctaaatgagttccctgcgacagtgtttgga
aaccctgaatatcagttctgcatcgatattgaaaaaattgagcttgctggtttcaccttt
acaaagccttgtactttagatgagttagttgatgagcaaaaagtcttttgggttgatttt
tctaaatcaacaatcattgctggcgatttcagttcaaaaaatacttacctagttactctt
gtaaataatggtgtagtacagagagattttgaaaatgcccagttgtttttaaaaggcttt
caagcatttgttggaatcaatcaagaaattactcttactacttgcgatccgatttttaat
gatgcaaacgaagatgaggatctttctacagaaacaaagtcggtaaaatcaaaaggcaaa
aagaaaacaaaagaagtgtcagcagatccacaattattggaaaccgaaaaggacattatt
cttgacggtattagctccagcaaaacagagtgtgaaattgattcgctttgctttggcctt
gaaaaacactctttcacccctgaccagcttaaagcaattgaagatgctaaaaatacgaag
cttgctgaattagccgaaatcaaatctaaggctgaggatgaaaaacatgacttacttaat
ttagctgaagcgaaaactcaagatccggaattatcagttttatgtgaagcctttattgat
gagatttctaattctaagagtaaagaagacttagattttattcgtgctcgtataaattct
aacggcgttttaacagaagttgaaaatgcagaattaaatacacgcctaaacattaaagct
aaatcatttgaaaaagttgatgtctatgtaaatgttccagacgcttctcaaaacaatggc
aaaaagtacattgaagaggaagaaggtaaatatcagaaaaaacttgctgaattaaaaaag
cgcgtagacgaatcaaagacagtaacagaagttaatgctgtaactaaatacacaaattca
tggtcagctgagcagcgcgcaccattgttgcaatatatgcataaacgcctcgaggagctt
aaaaaagagaagcaagctaatgaaccatcattgcttgtgaaaatccaaaatgcccctgac
ttagctactttagatgcatatgaaattgatattcacagtttagatccgcttgctcaaccg
aagatgatgcaagccgtaacagctcgaaaacttgaacttgaaaagcctaatactagctct
tctatctatttgatcgatgaggatctgccatga

DBGET integrated database retrieval system