KEGG   Acinetobacter baumannii ACICU: ACICU_02772Help
Entry
ACICU_02772       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PyocinActivator
Motif
Other DBs
NCBI-ProteinID: ACC58084
Position
2932111..2932395
Genome map
AA seq 94 aa AA seqDB search
MAAAQKIDDPFDTLLLLQMKYRKPVVTLEELLPDYLPHLSPPQANKRANKCDLPFPVFKP
DGKYSPWCAHLNDVALWLKSKQEEARADWRAMHS
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcacaaaaaattgatgaccctttcgatactcttttattgcttcagatgaaa
taccgcaaaccagtggtaacacttgaagaactattgccggattatttgccacatctttcg
ccgccacaggcaaacaaacgtgcaaataaatgtgatttaccatttccagtttttaagccg
gatggtaaatattcaccttggtgtgcacatttaaatgatgtagcattatggctgaagagc
aaacaagaagaagctagagccgactggcgcgcaatgcatagctaa

DBGET integrated database retrieval system