KEGG   Acinetobacter baumannii ACICU: ACICU_02775Help
Entry
ACICU_02775       CDS       T00710                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00330  Arginine and proline metabolism
abc00332  Carbapenem biosynthesis
abc01100  Metabolic pathways
abc01130  Biosynthesis of antibiotics
abc01230  Biosynthesis of amino acids
Module
abc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ACICU_02775
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ACICU_02775
Enzymes [BR:abc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ACICU_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACC58087
UniProt: B2HWM8
Position
complement(2934506..2935639)
Genome map
AA seq 377 aa AA seqDB search
MIEVVDGQRKLSECKRIVVKIGSSLLTANGQGLDLDAISHWAKQIADLHNAGHEIILVSS
GAVAEGMVRMKLASRPTDLPSLQACAAIGQMGLIHTWSSVLENHSIRTAQVLLTHDDLAD
RRRYLNSCDALQNLIDWRVIPVINENDTVSTDEIRFGDNDTLAAMVAGQVHADLLIILTD
QQGMFDSDPRHNPDAKLLSTVRAMDDVLFEMAGGGGVLGRGGMVTKVRAARLAAKSGCPT
LIASGESDNVLSRVMAGEMLGTLFTTDKDRMTAHQQWLAAHLQTAGRLVIDDGAVEAIKL
KHRSLLPVGVKTVEGHFDRGDVVECVDKQGKRVAVGRVNFSSRSAEIIKGLSSDKVYQVL
GEARSLEMIHRDHMAIY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagtggtcgatgggcaacgtaagctcagtgagtgtaaacgaatcgttgttaaa
atcggatcatctttactcacggcaaatgggcagggtctagatctggacgctatttcgcat
tgggcgaaacagattgcagatttacacaatgctggacacgaaattattttagtgtcttca
ggagctgtggcagaaggtatggttcgtatgaagcttgcgagtcgacccaccgatctaccc
agtcttcaagcatgcgccgcaattgggcagatgggcctaattcatacttggtctagtgtg
cttgaaaatcatagtatccgaactgctcaggtgttgttaacacatgatgatttggcagac
cgccgtcgttacttaaattcatgtgatgcattgcagaacttgattgattggcgtgttatt
ccggtcattaatgaaaacgatactgtatctaccgatgagattcgttttggtgataacgat
acactagcagctatggttgctggtcaagtacatgctgatttattaattattttaacagat
cagcaaggtatgtttgattcagacccacgtcataatcctgatgcaaagttattatcaact
gtgcgtgccatggatgatgttttatttgaaatggctggtggtggcggtgtgcttggacga
ggtggcatggtcactaaagttcgtgctgcacgtttagctgccaagtcaggttgcccgaca
ttgattgctagtggtgaaagcgacaatgtgttgtcacgagtgatggctggtgagatgctg
ggtacattgtttacgactgataaagaccgtatgacagcgcatcagcaatggcttgctgca
catttacaaacagcgggtcgtcttgtaattgatgatggcgcagttgaagcgattaaattg
aaacatcgcagtttattgcctgttggggtaaaaactgttgaaggacattttgatcgtggt
gatgtggttgaatgtgtcgataaacaaggtaaacgtgttgcggttgggcgagtgaatttt
agctctcgttctgctgaaattattaaaggtctttcttcagacaaagtttatcaagtactt
ggtgaagcccgttcattagaaatgattcatcgcgatcatatggcaatttactaa

DBGET integrated database retrieval system