KEGG   Acinetobacter baumannii ACICU: ACICU_02776Help
Entry
ACICU_02776       CDS       T00710                                 

Definition
(GenBank) predicted GTPase
  KO
K03979  GTPase [EC:3.6.5.-]
Organism
abc  Acinetobacter baumannii ACICU
Brite
Enzymes [BR:abc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     ACICU_02776
Ribosome biogenesis [BR:abc03009]
 Prokaryotic Type
  GTPases
   ACICU_02776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP1_OBG MMR_HSR1 FeoB_N ArgK ATP_bind_1 Gtr1_RagA RsgA_GTPase Arf AAA_16 GTP_EFTU AAA_18
Motif
Other DBs
NCBI-ProteinID: ACC58088
UniProt: B2HWM9
Position
complement(2935655..2936875)
Genome map
AA seq 406 aa AA seqDB search
MRFVDEAVITVEAGDGGNGVASFRREKFVPFGGPDGGDGGRGGSIYIQADDDTSTLVDYR
YTRKFRAERGKNGAGANCTGRGGEDVVLKVPVGTTIVDTDSGDIIGDLVEDGQRVMVASG
GEGGLGNTHFKSSTNRAPRKCTTGTKGEFREIRLELKVLADVGLLGMPNAGKSTFIRAVS
AAKPKVADYPFTTMVPNLGVVDADRHRSFVMADIPGLIEGAAEGAGLGIRFLKHLARTRI
LLHIIDVQPIDGSDPAHNAKAIMNELAKFSPTLAKLPIVLVLNKLDQIAEESREEWCQHI
LDELQWTGPVFKTSGLLEEGTKEVVYYLMDQIEQQREREVEDPEYAAEVRAFREQLEAET
REQTIAAKEAYRAMRKAQRLESMMDDDDDFDDDEDDGDVESIYVRD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttgttgatgaagcagtcattaccgtagaggctggcgacggtggcaatggcgta
gccagttttcgccgtgaaaaatttgtaccatttggtggcccagatggtggtgatggcgga
cgtggtggaagtatctatattcaagcagatgatgatacaagtaccctagtcgattaccgt
tacacccgtaaattccgcgctgagcgtggtaaaaacggtgcaggtgctaactgtaccgga
cgtggtggtgaagatgtggttttaaaagtacccgttggtacaacaattgttgatacagat
tcaggcgatattattggcgatctggtagaagacggccaaagagtcatggttgcaagcggt
ggtgaaggtggtttaggaaatactcactttaaatcatcaaccaaccgtgctccacgtaaa
tgtacgacaggtacaaaaggtgagttccgtgaaattcgccttgagttgaaagtattagca
gatgttggcttattaggtatgccaaatgctggtaaatcaacatttattcgtgcagtaagt
gccgcgaaaccaaaagtagcagattatccatttaccactatggttcctaacctaggtgta
gtagatgctgaccgtcaccgctcgtttgtgatggcagatattccgggacttattgagggt
gcagcagaaggtgcaggtttaggtattcgtttccttaagcatttagcacgtacacgtatt
cttttgcacattattgatgtacaaccaattgatggttcagatccggcccataatgctaaa
gcaattatgaatgaacttgccaagttttctcctactttggcgaagttaccaattgtatta
gtacttaataaacttgatcagattgctgaagaaagccgtgaagaatggtgtcagcatatt
ctagatgagttgcaatggacaggtcctgtctttaagacctcgggtttactcgaagaagga
accaaagaagttgtttattacctcatggatcagattgaacaacaacgtgaacgtgaagtt
gaagatcctgagtacgcagcagaagtaagagcattccgtgaacagcttgaagctgaaaca
cgtgaacagaccattgcagcgaaggaagcatatcgtgctatgcgtaaggcacaacgcctt
gaaagcatgatggacgatgatgatgacttcgatgacgatgaagacgatggtgatgtagaa
agcatctacgttcgtgactaa

DBGET integrated database retrieval system