KEGG   Acinetobacter baumannii ACICU: ACICU_02778Help
Entry
ACICU_02778       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_19
Motif
Other DBs
NCBI-ProteinID: ACC58090
Position
complement(2937726..2938349)
Genome map
AA seq 207 aa AA seqDB search
MKNQAVAIDLQEPLQVQVKVKDALNVDVKGRVNANIPINEKLNIPLTQTLTPRVYFDNMV
PISTVIPVKETLKVDQSLPIDTKVQVRVLGKDITLPLKGNIPLQLDVPIDIQVPLDQKVH
LKFDAPVKTVLKENLHIPLNAQLKTNIPIQGSLNVPVKTALNASVDVKNTLPVKIEHGEL
KIPLSSMSLNRVKSGEDHSSPVQNQTK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaccaagcagtagcgatcgatttacaagaaccattacaggtacaagttaaagta
aaagatgctttaaatgtcgatgtaaaagggcgagtgaatgctaatattcctattaatgag
aagttaaatattcctttgacgcagactttaacaccacgtgtctatttcgataatatggtg
ccgattagtacggttattccagttaaagaaactttaaaagttgaccaaagtttgccaatt
gacacgaaagttcaggtgagagtacttggtaaagatattactttgccattaaaaggtaat
attcctttacagttggatgtacctattgatatacaagttccactcgatcaaaaagttcat
ttgaagtttgatgcgccagtaaaaacggtcttaaaagaaaatcttcatattccattaaat
gctcaattaaaaacaaatattccaattcagggaagtttgaatgtccctgtgaaaacagct
ttaaatgcgtcggtagatgtaaaaaataccttgccagttaaaatcgagcatggtgagtta
aaaataccactatcgagcatgagcctgaatcgcgttaaatctggcgaagatcactcttca
cctgttcagaaccagacaaaatag

DBGET integrated database retrieval system