KEGG   Acinetobacter baumannii ACICU: ACICU_02790Help
Entry
ACICU_02790       CDS       T00710                                 

Definition
(GenBank) Short-chain alcohol dehydrogenase of unknown specificity
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase F420_oxidored Polysacc_synt_2 GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: ACC58102
Position
complement(2950298..2951056)
Genome map
AA seq 252 aa AA seqDB search
MLALVTGASAGFGYSISKKLIESGYKVIGCGRRAEKLEELQKQLGENFYPLVFDMTDTAE
NINKLFKELPNEFQIDQIDLLVNNAGLALGLEPADKADLDDWYTMIDTNVKGLVTVTRLI
LPSMVKKKSGLIINMGSIAGTYPYPGGNVYGATKAFVEQFSLNLRADLAGTGVRVTNIEP
GLCGGTEFSLVRFKGDQEKANSLYDKKNPILPEDIANTVAWIASQPPHININRIEMMPTT
QTFNPLKVVEVE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttagcattagttacaggcgcatcagcaggttttggttatagtatttcaaagaaactg
attgagtcaggctataaagttattggatgtggaagacgcgcagaaaaattagaagaacta
caaaaacagcttggcgaaaatttctacccactcgtatttgatatgactgatacggcagaa
aatataaataagttatttaaagaattaccaaatgaatttcaaatcgatcaaattgactta
ctagtgaataatgcaggcttggcattgggtctagagccagcagataaagcggatttagat
gattggtacaccatgattgataccaatgttaaaggccttgttacggttacccgattaatt
ttaccaagtatggtaaagaagaaatcaggcttaatcattaatatgggttcaattgcaggt
acatacccatatccaggtggtaatgtgtatggggcaacaaaagcttttgtagagcagttt
agtttaaatctacgtgcagatttggctggtactggcgtgcgagtaacgaatattgagcca
gggttgtgtggtggtaccgaattttctcttgtacgttttaagggggatcaggagaaagct
aatagtctatacgataagaaaaatccaattttgccggaagatattgcaaatacagtagca
tggatcgcatcacaaccaccgcatattaatattaaccgtatagaaatgatgccaacgact
cagacttttaaccctttaaaagttgtagaagtggaataa

DBGET integrated database retrieval system