KEGG   Acinetobacter baumannii ACICU: ACICU_02799Help
Entry
ACICU_02799       CDS       T00710                                 

Definition
(GenBank) Membrane GTPase LepA
  KO
K03596  
GTP-binding protein LepA
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2956676..2958493)
Genome map
AA seq 605 aa AA seqDB search
MAQAKKSVDIKNIRNFSIIAHIDHGKSTLADRFIQMCGGLQDREMQAQVLDSMELERERG
ITIKAASVTLYYTHPNGQEYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQ
SVANCYTAIEQGLEVLPILNKIDLPQAEPERVIHEIEEIIGIEATNAPTCSAKTGLGVEG
VLETLVDVIPAPTGDREAPLQALIIDSWFDNYLGVVSLVRIKDGRIRKGDKMLVKSTGQT
HIVTSVGVFNPKHTETGVLEAGEVGFVIAGIKDIFGAPVGDTITLSTTPEVASLPGFKKV
KPQVYAGLFPIDASDFEPFREALQKLQINDSALFFEPESSDALGFGFRCGFLGMLHMEIV
QERLEREYDLDLISSAPTVVYEAVTKKGDTIYIDSPSKMPDGSVVEDLREPIAECHILVP
QEYLGNVMTLCIERRGVQKDMKFLGNQVSITFEIPMAEVVMDFFDKLKSCSRGFASLDYN
FIRFESSSLVKVDVLINGEKVDALAMICHRNDARHRGIALVEKMKDLIPRQMFDVAIQAA
IGAQIIARSTVKAMRKNVLAKCYGGDVSRKKKLLAKQKEGKKRMKQVGSVEIPQEAFLAV
LKVER
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagctaaaaaatccgttgatatcaaaaatatccgaaatttctcgattatcgct
catattgatcatggtaagtctactttggctgaccgttttattcagatgtgtggtggcctg
caagatcgtgagatgcaagctcaggtcttggactcaatggagctcgagcgtgaacgtggg
attaccattaaagctgcttcggtgacgttgtactatactcatccaaacgggcaggaatat
cagcttaactttattgatactccgggacacgttgatttctcttatgaagtatctcgttca
ttagctgcttgtgaaggtgcgttattggttgtggatgctgcacaaggggtagaagcacaa
tcagttgcaaactgttataccgctattgagcaaggtctcgaagttcttccaattttaaat
aaaattgatttgccgcaagcagagcctgagcgcgttattcatgaaattgaagaaattatc
ggtattgaagcaaccaatgcacctacatgttctgcaaaaacaggcttaggcgttgaaggt
gttttagaaacattagttgatgttattcctgctccaacaggtgaccgtgaggctccttta
caagcattaatcattgactcatggtttgataactatttaggtgttgtctctttagttcgt
attaaagatggtcgtatccgcaagggcgacaaaatgttggttaaatctaccggtcagact
catattgttacatcggtaggtgtattcaaccctaaacatactgaaactggcgtgcttgaa
gctggtgaagtaggctttgttatcgcgggtattaaagatatttttggtgcgccggtaggt
gataccatcacgctttcaacaacccctgaagtagcttcacttcctggttttaaaaaggtt
aaacctcaggtttacgcaggccttttcccaattgatgcaagcgattttgaaccattccgc
gaagccttacaaaaactacagatcaatgactcggctttattctttgaacctgaaagttca
gatgcgcttggttttggtttccgttgtggtttcttgggcatgttgcacatggaaatcgta
caagagcgtttagagcgcgagtatgaccttgatttgatcagctcagcgccaacggtagtg
tatgaagctgtcactaaaaaaggcgatacgatctatatcgatagtccatctaaaatgccg
gatggttctgttgttgaagatttgcgtgagccaattgcagagtgtcatattcttgtaccg
caagagtacttaggtaacgtcatgaccctatgtattgagcgccgtggtgtacaaaaagac
atgaaattcttaggtaatcaagtttcaattacttttgaaattcctatggctgaagtggtt
atggacttctttgataagcttaaatcatgttcacgtggttttgcttcacttgactataac
tttattcgttttgagagttcatctttagttaaggttgacgtgttaattaatggtgagaag
gtcgatgcgcttgcaatgatttgtcaccgtaatgatgctcgtcatcgtggtattgcttta
gttgagaaaatgaaagatttgattccacgtcaaatgttcgatgtcgcaattcaggctgct
attggtgcacaaattattgctcgttcgaccgtgaaggcgatgcgtaaaaacgttttagca
aaatgttatggcggtgacgtgtctcgtaagaagaaactacttgcgaaacaaaaagaaggt
aagaaacgtatgaaacaagtgggtagtgtagaaatcccacaagaagcgttcttagctgtt
ttgaaagtagaaagataa

DBGET integrated database retrieval system