KEGG   Acinetobacter baumannii ACICU: ACICU_02799Help
Entry
ACICU_02799       CDS       T00710                                 

Definition
(GenBank) Membrane GTPase LepA
  KO
K03596  GTP-binding protein LepA
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU LepA_C EFG_C GTP_EFTU_D2 RF3_C Ras MMR_HSR1 EFG_II SRPRB
Motif
Other DBs
NCBI-ProteinID: ACC58111
UniProt: B2HWQ2
Position
complement(2956676..2958493)
Genome map
AA seq 605 aa AA seqDB search
MAQAKKSVDIKNIRNFSIIAHIDHGKSTLADRFIQMCGGLQDREMQAQVLDSMELERERG
ITIKAASVTLYYTHPNGQEYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQ
SVANCYTAIEQGLEVLPILNKIDLPQAEPERVIHEIEEIIGIEATNAPTCSAKTGLGVEG
VLETLVDVIPAPTGDREAPLQALIIDSWFDNYLGVVSLVRIKDGRIRKGDKMLVKSTGQT
HIVTSVGVFNPKHTETGVLEAGEVGFVIAGIKDIFGAPVGDTITLSTTPEVASLPGFKKV
KPQVYAGLFPIDASDFEPFREALQKLQINDSALFFEPESSDALGFGFRCGFLGMLHMEIV
QERLEREYDLDLISSAPTVVYEAVTKKGDTIYIDSPSKMPDGSVVEDLREPIAECHILVP
QEYLGNVMTLCIERRGVQKDMKFLGNQVSITFEIPMAEVVMDFFDKLKSCSRGFASLDYN
FIRFESSSLVKVDVLINGEKVDALAMICHRNDARHRGIALVEKMKDLIPRQMFDVAIQAA
IGAQIIARSTVKAMRKNVLAKCYGGDVSRKKKLLAKQKEGKKRMKQVGSVEIPQEAFLAV
LKVER
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagctaaaaaatccgttgatatcaaaaatatccgaaatttctcgattatcgct
catattgatcatggtaagtctactttggctgaccgttttattcagatgtgtggtggcctg
caagatcgtgagatgcaagctcaggtcttggactcaatggagctcgagcgtgaacgtggg
attaccattaaagctgcttcggtgacgttgtactatactcatccaaacgggcaggaatat
cagcttaactttattgatactccgggacacgttgatttctcttatgaagtatctcgttca
ttagctgcttgtgaaggtgcgttattggttgtggatgctgcacaaggggtagaagcacaa
tcagttgcaaactgttataccgctattgagcaaggtctcgaagttcttccaattttaaat
aaaattgatttgccgcaagcagagcctgagcgcgttattcatgaaattgaagaaattatc
ggtattgaagcaaccaatgcacctacatgttctgcaaaaacaggcttaggcgttgaaggt
gttttagaaacattagttgatgttattcctgctccaacaggtgaccgtgaggctccttta
caagcattaatcattgactcatggtttgataactatttaggtgttgtctctttagttcgt
attaaagatggtcgtatccgcaagggcgacaaaatgttggttaaatctaccggtcagact
catattgttacatcggtaggtgtattcaaccctaaacatactgaaactggcgtgcttgaa
gctggtgaagtaggctttgttatcgcgggtattaaagatatttttggtgcgccggtaggt
gataccatcacgctttcaacaacccctgaagtagcttcacttcctggttttaaaaaggtt
aaacctcaggtttacgcaggccttttcccaattgatgcaagcgattttgaaccattccgc
gaagccttacaaaaactacagatcaatgactcggctttattctttgaacctgaaagttca
gatgcgcttggttttggtttccgttgtggtttcttgggcatgttgcacatggaaatcgta
caagagcgtttagagcgcgagtatgaccttgatttgatcagctcagcgccaacggtagtg
tatgaagctgtcactaaaaaaggcgatacgatctatatcgatagtccatctaaaatgccg
gatggttctgttgttgaagatttgcgtgagccaattgcagagtgtcatattcttgtaccg
caagagtacttaggtaacgtcatgaccctatgtattgagcgccgtggtgtacaaaaagac
atgaaattcttaggtaatcaagtttcaattacttttgaaattcctatggctgaagtggtt
atggacttctttgataagcttaaatcatgttcacgtggttttgcttcacttgactataac
tttattcgttttgagagttcatctttagttaaggttgacgtgttaattaatggtgagaag
gtcgatgcgcttgcaatgatttgtcaccgtaatgatgctcgtcatcgtggtattgcttta
gttgagaaaatgaaagatttgattccacgtcaaatgttcgatgtcgcaattcaggctgct
attggtgcacaaattattgctcgttcgaccgtgaaggcgatgcgtaaaaacgttttagca
aaatgttatggcggtgacgtgtctcgtaagaagaaactacttgcgaaacaaaaagaaggt
aagaaacgtatgaaacaagtgggtagtgtagaaatcccacaagaagcgttcttagctgtt
ttgaaagtagaaagataa

DBGET integrated database retrieval system