KEGG   Acinetobacter baumannii ACICU: ACICU_02801Help
Entry
ACICU_02801       CDS       T00710                                 

Definition
(GenBank) Trypsin-like serine protease, typically periplasmic
  KO
K04771  
serine protease Do [EC:3.4.21.107]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Two-component system
Brite
KEGG Orthology (KO) [BR:abc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ACICU_02801
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ACICU_02801
Enzymes [BR:abc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     ACICU_02801
Peptidases [BR:abc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   ACICU_02801
Chaperones and folding catalysts [BR:abc03110]
 Other chaperones and cochaperones
  DegP / HtrA
   ACICU_02801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2959241..2960617)
Genome map
AA seq 458 aa AA seqDB search
MKSRYLQQGMYAAVFTVAAVQANAAVDFSNLVEQVSPAVVSVNVVKKMTQDELLQQQVPE
ILKRFFGNQVIIPQQQGPQEKTAYGSAFFISKDGYLLTNHHVIENASRISITLNDRREID
ATVVGSDERTDVALLKVNGTNYPALRVGNVDRLRVGEPVLAIGSPFGFDYSASAGIVSAK
SRNMSGETSVPFIQTDVALNPGNSGGPLFNQNGEVVGVNSRIFSGTGGYMGLSFSIPIDV
AMDVAEQLKTKGKVTRSYLGVMMQDIDRNLADAYKLPKPEGALITQVSPNSPAQKAGLRA
GDVILKLNGASVLRTSDLLYALNKVQPNQTVQFEVLRDDKTRNISATLATAPDETPATGN
QASASKGPVLGMSIRDLAVPEKNALGIKGGIYVQDVRRGGLASLSNIIPGDVIIQVNNTQ
ILNSQDFAKVVSNLPKNTVARVGIIRQGQRAMLGLRIQ
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctcgctatttacaacaaggaatgtatgcagcggtatttacagttgctgctgtt
caagcaaatgctgctgttgatttttcaaacctcgttgaacaagttagtccggctgtggtg
agtgtaaacgttgtaaaaaaaatgactcaggatgaactgttacaacagcaagttcctgaa
attttaaaacgtttctttggtaatcaggtcatcattccacagcaacaaggtcctcaagag
aaaaccgcatatggtagtgcgttctttattagtaaagatggttatttacttacgaaccac
catgtaattgaaaatgcttcccgcatcagtattactttaaatgaccgtcgtgaaattgat
gcaacggtggtcggtagtgatgagcggacagacgttgcattattaaaggtaaacggaact
aactatcctgctttacgagtaggaaatgttgaccgtttacgtgtaggagagccggtttta
gcaattggttcaccatttggttttgattattcagcttcggcaggtattgttagcgctaaa
tcacgtaacatgagcggtgaaacctctgtaccatttattcaaaccgatgtggcgttgaac
cctggtaactcaggcggtccattgtttaaccagaatggtgaagttgtcggggtgaactca
cgtatctttagtggtacgggtggctatatgggcttatctttctctattccaattgatgtt
gcgatggatgtagctgaacagcttaaaacgaaagggaaagtgactcgttcatacttgggt
gtcatgatgcaagatattgaccgtaaccttgcagatgcctataaattacctaaaccggaa
ggtgctctgattactcaggtttctccaaattcacctgctcaaaaagcagggcttagagct
ggcgatgttattctaaaattaaatggtgcttctgtactgcgtactagtgatttgctttat
gcattaaataaagtacaaccaaaccaaactgttcagtttgaagttttacgtgatgataaa
acccgaaatatctcggcaacactagcaactgcacctgatgaaacaccagctaccggtaat
caagcctctgcttctaaaggtccagtattgggaatgagtattcgtgatctcgctgtgcca
gagaaaaatgctttaggtataaaaggtggtatttatgtacaagatgtccgccgtggtgga
ttagcatcattgtcaaatatcattcctggcgatgtgattattcaggttaataatactcag
attttgaacagtcaggattttgcaaaagttgtttcgaatttgccgaaaaatacagttgcg
cgagttgggattattcgtcaaggacaacgagcaatgcttggtttacgtattcagtaa

DBGET integrated database retrieval system