KEGG   Acinetobacter baumannii ACICU: ACICU_02814Help
Entry
ACICU_02814       CDS       T00710                                 

Definition
(GenBank) Tetrahydrodipicolinate N-succinyltransferase
  KO
K00674  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00300  Lysine biosynthesis
abc01100  Metabolic pathways
abc01120  Microbial metabolism in diverse environments
abc01230  Biosynthesis of amino acids
Module
abc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ACICU_02814
Enzymes [BR:abc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     ACICU_02814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THDPS_N_2 Hexapep_2 Hexapep
Motif
Other DBs
NCBI-ProteinID: ACC58126
UniProt: B2HWR7
Structure
PDB: 

Jmol
Position
2972490..2973311
Genome map
AA seq 273 aa AA seqDB search
MSQLSTIIEQAFEDRANFTAADCPSEIRQAVEEAIAGLDNGTLRVAEKINGEWVVHQWLK
KAVLLSFKLNDNKPIESCDLRFYDKVETKFSGWTEEQFKAAGVRVVPPAVARRGSFQAKN
VVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED
NCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVPGNLPS
ADGKYSLYAAIIVKKVDAQTRAKTSLNDLLRAD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagctttctacgatcattgagcaagcatttgaagaccgcgcaaatttcactgca
gcagattgcccaagcgaaattcgccaagctgttgaagaagcaattgctggtttagataac
ggtacacttcgagttgcagaaaaaatcaatggtgaatgggttgttcatcaatggttaaaa
aaagctgttttattatcatttaaacttaatgacaataaaccaatcgagtcatgtgatctt
cgtttctacgacaaagttgaaactaaattctctggttggactgaagagcaatttaaagct
gcaggcgttcgtgttgttcctcctgctgttgctcgtcgtggtagtttccaagctaaaaat
gtggtgttaatgccatcttatgtcaacattggtgcttacgtagatgaaggcacaatggtt
gatacatgggcaactgtaggttcatgtgctcaaatcggtaaaaacgttcatttatcaggt
ggtgttggtatcggtggtgttttagaaccattacaagctaacccaaccattattgaagac
aactgttttatcggcgcacgttctgaaatcgttgaaggtgttattgtcgaagaaggctct
gttatttctatgggtgtttatatcggtcaatctacacgtatttatgatcgtgagactggt
gaaatccattatggccgtgttcctgctggctcagttgttgtaccaggtaacttaccgtca
gctgatggtaaatacagcttatacgctgcaattatcgtgaaaaaagttgatgcacaaaca
cgtgcaaaaacaagtttgaacgatttgttacgcgctgactaa

DBGET integrated database retrieval system