KEGG   Acinetobacter baumannii ACICU: ACICU_02816Help
Entry
ACICU_02816       CDS       T00710                                 

Definition
(GenBank) predicted PP-loop superfamily ATPase
  KO
K06920  7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00790  Folate biosynthesis
abc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACICU_02816
Enzymes [BR:abc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     ACICU_02816
Transfer RNA biogenesis [BR:abc03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    ACICU_02816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueC Asn_synthase Arginosuc_synth ATP_bind_3 NAD_synthase AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACC58128
Position
2974141..2974812
Genome map
AA seq 223 aa AA seqDB search
MRPRAIVLLSGGLDSTTCLAWAQARYECIAISFMYGQRSTTELDAAKALAQRAGVEHRVI
NIDLANLGGSALTDHNIAVPEQLQEGIPVTYVPARNTIFLSYALAAAEVFNAEAIVIGIN
AVDYSGYPDCRPEFIDAFANMARLATKAGVEGKPLKFETPLLHLSKANIIRLGIEHGVDY
SQTVSCYQADAQGRACGKCDSCRLRKEGFIDAGVTDPTRYIPQ
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctcgtgccattgttttactttcaggcggcttagactcaaccacttgcctagct
tgggcacaagcgcgctatgaatgtattgctattagttttatgtatggtcaacgctcaacc
actgaacttgatgctgcaaaagcattagctcagcgtgcaggtgttgaacatcgtgtaatt
aatatcgatttagccaatttaggcgggtctgcacttacagatcataacattgctgtacca
gaacaattacaagaaggtattcctgtaacttatgtaccagcacgtaacacaattttcctc
tcttatgccttagcagcagcagaagttttcaatgctgaagcaattgttattggcatcaat
gctgttgattattcaggatatcctgactgtcgcccagaatttattgatgcttttgccaat
atggctcgtttagcaactaaagctggcgtagaaggaaaacctcttaaatttgaaacaccc
ctgttacatttatccaaagcgaatattatacgtttagggattgaacatggcgtagactat
agtcaaacggtatcttgctaccaagcagatgctcaaggacgtgcgtgtggtaaatgtgac
agttgccgtttgcgtaaagaaggctttatcgatgctggtgttaccgatccaacacgctat
ataccgcaataa

DBGET integrated database retrieval system