KEGG   Acinetobacter baumannii ACICU: ACICU_02817Help
Entry
ACICU_02817       CDS       T00710                                 

Definition
(GenBank) putative membrane protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
2974826..2975242
Genome map
AA seq 138 aa AA seqDB search
MKLLKSNLILSSLFSAAALMAGSAQAAENPVQAAYKSTNVKGALINVCKDQTAKGGKLSS
AEVSKFCSCQVEAQGKVTEAQKWEIQSAINAKKSPSSLAFVQQQNRDLKACFGPQLTTKL
EKLTEEAMKAAQQQAPKK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgttaaaatcaaatcttattctttcatctttattctcagcagctgcacttatg
gctggttcagctcaagcagctgaaaacccagttcaagcagcatataaaagcactaacgtt
aaaggtgcattaatcaacgtttgtaaagatcaaactgcaaaaggcggtaaattaagttca
gctgaagtaagcaaattctgtagctgccaagttgaagcgcaaggtaaagtgactgaagca
caaaaatgggaaattcaaagcgcaatcaatgcgaagaaaagcccaagctctttagctttt
gtacaacaacaaaaccgtgatcttaaagcatgtttcggtcctcagttaacaactaagctt
gagaaattaactgaagaagcaatgaaagcagctcaacaacaagctcctaaaaaataa

DBGET integrated database retrieval system