KEGG   Acinetobacter baumannii ACICU: ACICU_02923Help
Entry
ACICU_02923       CDS       T00710                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACICU_02923
Enzymes [BR:abc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ACICU_02923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3100609..3101460)
Genome map
AA seq 283 aa AA seqDB search
MQLISLPKQILQCGQLQLDLSQPHVMGILNVTPDSFSDGGKHNQLDQAVDHALSMIEQGA
TIIDIGGESTRPGASEVVVEEEVRRVVPVVEALSHHNVILSIDTSQPEVIRAAKAAGAHI
WNDVRALTRPNALKTAVELDIPVVIMHMRGEPTTMNQLDQYTDVTLDVMQELQQRIDEAL
AAGVKKHNIIVDPGFGFAKNAQQNLKLLKEFWKLNELGYPILSGLSRKRFIGEALQGAPA
DQRAVGSVTGHLLSIQQGASIVRAHDVKEMHEAILVWKAMQQV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaatatctttaccaaagcagattttacagtgtggacagcttcaattagattta
tctcagccccatgttatgggtatcttaaatgtcactcctgattctttcagtgatggtggt
aaacataaccaattagaccaagcggttgatcatgcacttagtatgattgagcaaggcgcg
actattattgatattgggggggaatctacccgacctggtgcttcagaagttgtagtagaa
gaagaagtgcgtcgtgtggtacctgtggtcgaggctttatctcaccataacgttattttg
tcgatcgacacaagtcagccagaagttattcgcgcagcaaaagcagcaggggcacatatc
tggaatgatgtccgtgccttaacacgtcccaatgctttaaaaactgccgtagaattagat
atacctgtagtaattatgcatatgcgcggtgaaccaacgacaatgaatcagttggatcag
tacactgatgtaacactcgatgtgatgcaagagttgcaacagcgtattgatgaggctttg
gctgctggggtaaaaaagcacaatattattgttgatcctggatttggctttgcgaaaaat
gcccagcaaaatttaaaactattaaaagaattttggaaacttaatgaacttggttatcca
attttatccgggctttctcgtaaacgtttcataggtgaagctttacaaggcgctcctgca
gatcaacgtgctgtgggaagtgtaactgggcatttgcttagtattcagcagggagcatcc
attgtaagagcgcatgatgtaaaggaaatgcatgaagcaattttagtttggaaagcgatg
cagcaagtctga

DBGET integrated database retrieval system