KEGG   Acinetobacter baumannii ACICU: ACICU_02924Help
Entry
ACICU_02924       CDS       T00710                                 

Definition
(GenBank) ATP-dependent Zn protease
  KO
K03798  
cell division protease FtsH [EC:3.4.24.-]
Organism
abc  Acinetobacter baumannii ACICU
Brite
Enzymes [BR:abc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     ACICU_02924
Peptidases [BR:abc01002]
 Metallo Peptidases
  Family M41: FtsH endopeptidase family
   ACICU_02924
Chaperones and folding catalysts [BR:abc03110]
 Other chaperones and cochaperones
  AAA proteases
   ACICU_02924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3101592..3103388)
Genome map
AA seq 598 aa AA seqDB search
MKYSDFVAAVNAGQIKQVTIDGLNISGEKTNGSQFETVRPQVEDTELMPSLNKQNVVVEG
TAPQRQGILMQLLIASFPVLLIILLFMFFMRNMGGGAGGKNGPMSFGKSKAKMLSEDQIK
VTFADVAGCDEAKQEVVEIVDFLKDPAKFKRLGATIPRGVLMVGPPGTGKTLLAKAIAGE
AKVPFFSISGSDFVEMFVGVGASRVRDMFEQAKRHAPCIIFIDEIDAVGRHRGSGTGGGH
DEREQTLNQMLVEMDGFEGNEGVIVIAATNRVDVLDKALLRPGRFDRQVMVGLPDIRGRE
QILNVHLKKLPSVTGVDVKVLSRGTPGFSGAQLANLVNEAALFAARRNKNTVDMHDFEDA
KDKIYMGPERKSMVLREEERRATAYHEAGHAIVAEILPGTDPVHKVTIMPRGWALGVTWQ
LPEQDQISHYKDKMLNEIAILFGGRIAEEVFIQQQSTGASNDFERATKMARAMVTKYGMS
DKMGVMVYEDENQNGFFGNVGSRTISEATQQQVDQEVRRILDEQYKVARDILENNKDIAH
AMVKALMEWETIDRDQIRDIMEGREPQPPKVYIAENPVSAFEPPKDGPSTPPPLPAMN
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattcagattttgttgcagcggtgaatgctggccaaattaagcaagtcacgatt
gacggtttaaatattagtggtgaaaaaactaacggatctcagtttgaaactgttcgtccg
caggttgaagacactgaacttatgccaagcttaaacaagcaaaatgttgttgtagagggc
acagcaccacaacgtcaaggcattttgatgcaacttctcattgctagtttccctgtactg
ttaatcattttgttattcatgttctttatgcgtaacatgggtggtggtgcaggcggcaaa
aatggtccgatgagttttggtaagtcgaaggcaaaaatgctttctgaagaccaaatcaaa
gtgacttttgctgacgttgccggttgtgatgaagcgaaacaagaagttgtggaaattgta
gatttcttaaaagatcctgcaaaattcaaacgcttgggcgctactattccacgtggcgtg
cttatggttggtcctccaggtactggtaaaacgttattagccaaagcaattgctggtgaa
gcaaaagttccattctttagcatttctggttctgactttgttgagatgtttgtgggtgtg
ggtgcgtcccgtgtccgtgatatgtttgaacaagcaaaacgtcatgcgccatgtattatc
tttattgatgagattgacgcagtaggtcgtcaccgtggttcaggtacaggtggtggtcat
gatgaacgtgagcaaaccttaaaccaaatgctcgtagagatggacggttttgaaggtaat
gaaggcgtaatcgttattgctgcgactaaccgtgttgacgtattagataaagcattgtta
cgtccaggccgcttcgaccgtcaagttatggttggtttacctgacatccgtggtcgtgaa
caaattctgaatgtacatttgaaaaaattgccttcagttactggtgtagatgttaaagtt
ttatctcgtggtacacctggtttctctggtgctcagttggcaaaccttgtaaatgaagct
gctttgtttgctgctcgccgtaataagaacactgtcgatatgcatgactttgaagatgca
aaagacaagatctatatgggtcctgaacgtaaatcaatggttctacgtgaagaagagcgt
cgcgcaactgcttaccatgaagctggacatgcaattgttgctgagattttaccgggtact
gaccctgtgcataaggtaacaattatgccgcgtggttgggctttaggtgtaacttggcag
ttacctgaacaagatcagattagccactataaagacaaaatgctaaatgaaattgcaatt
ttgtttggtggacgtattgctgaagaagtcttcattcagcaacaatcgactggtgcttca
aatgacttcgaacgtgctacaaaaatggctcgtgcgatggtaacgaagtacggtatgtct
gacaaaatgggtgtgatggtttacgaagatgaaaaccaaaatggattcttcggtaacgta
ggtagccgtacaatttctgaagcgactcaacaacaagttgatcaggaagtacgccgtatt
ttagatgaacaatataaagttgctcgtgatatcttggaaaataataaagatatcgcccat
gcaatggttaaagcgttgatggaatgggaaactattgatcgtgaccaaatccgtgacatc
atggaaggccgcgaacctcaaccaccgaaagtttatattgctgaaaatccggtatctgcg
tttgagccgccaaaagatggtccatctactccgccgccattaccagcgatgaattaa

DBGET integrated database retrieval system