KEGG   Acinetobacter baumannii ACICU: ACICU_02929Help
Entry
ACICU_02929       CDS       T00710                                 

Definition
(GenBank) Carbamoylphosphate synthase small subunit
  KO
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ACICU_02929
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACICU_02929
Enzymes [BR:abc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     ACICU_02929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3106307..3107446
Genome map
AA seq 379 aa AA seqDB search
MSTPAILALADGTIFKGTSIGATGSTTGEVVFNTAMTGYQEILTDPSYAQQIVTLTYPHI
GNTGCNEEDVESGRIHKVWANGLIIRDLPLLHSNFRSEQSLSEYLQAHNVVAIADIDTRK
LTRILRDKGAQNGCILAGENITEEEAIAKARAFGGLNGLDLAKECCDPTGFEWSEGSWVL
GKGFTQPELKYHVVAYDYGVKTNILRMLADRGCKLTVVPAETPAEKVLALNPDGVFLSNG
PGDPAACDYAIEAVKTIVETTTLPVFGICLGHQILALASGAKTVKMNHGHHGANHPVQNL
EDGTVMITSQNHGFAVDAETLPANLKATHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGP
HDCAPLFDHFIELIEASKQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgagcacccccgccattttagccctcgcagatggaacgatctttaaaggaacgtcaatc
ggcgcaacgggaagtacgactggagaagtcgtttttaacacagccatgacaggctatcaa
gaaattttgactgacccaagttatgcacaacaaattgtgacattaacttaccctcatatt
ggtaacactggttgcaacgaagaagacgttgaatctggtcgtatccataaagtatgggcg
aatggtttaattattcgtgaccttccactattacacagcaacttccgttctgagcaatca
ttaagtgaatatttgcaagcgcacaatgttgtcgcaattgctgatattgacacacgtaaa
cttactcgtattttacgtgataaaggtgcacaaaatggttgcatccttgccggcgaaaat
attactgaagaagaagctattgctaaagctcgcgcttttggtggtttaaatggtttagac
cttgcaaaagagtgctgtgacccgacaggctttgaatggtctgaaggttcgtgggtatta
ggtaaaggctttactcaacctgagttaaaataccatgtggttgcatacgattatggtgtc
aaaaccaacatcttgcgtatgcttgcagaccgcggttgtaaactcactgttgtccctgct
gaaactccggctgaaaaagtattagcacttaatccggatggcgtattcctttcaaacggc
cctggcgacccagctgcttgtgattacgctatcgaagctgtaaaaactattgttgaaacc
acaacattacctgtatttggtatctgtttaggacatcaaatcttggcactcgcttctggt
gcaaaaactgtaaaaatgaatcatggtcaccacggtgcgaaccaccctgtacaaaatctt
gaagatggtacagtgatgattacatctcaaaaccatggttttgctgtagatgcagaaaca
ttaccggctaacttaaaagcaacgcataaatcattgttcgatggcactctacaagggatt
catcgtacagacaaaccagctttcagcttccaaggtcaccctgaagcaagcccaggtcca
catgactgtgcacctttgttcgatcatttcatcgaacttattgaagcatctaaacagtaa

DBGET integrated database retrieval system