KEGG   Acinetobacter baumannii ACICU: ACICU_02931Help
Entry
ACICU_02931       CDS       T00710                                 

Definition
(GenBank) Transcription elongation factor
  KO
K03624  transcription elongation factor GreA
Organism
abc  Acinetobacter baumannii ACICU
Brite
Transcription machinery [BR:abc03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription elongation factors
     ACICU_02931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GreA_GreB_N GreA_GreB DUF3888 Cadherin
Motif
Other DBs
NCBI-ProteinID: ACC58243
Position
3110779..3111255
Genome map
AA seq 158 aa AA seqDB search
MQRYPMTPEGKIALEKELQHLKTVERPRITQAIAEAREHGDLKENAEYHAAREQQGFCEG
RIQDIEGKLGAAQVIDVKDLEQNGRVVFGVTVTIENLDTEERKTYKIVGDDEADFKINKI
SVNSPIARGLLGKNEGDEVKITTPQGEVEYEVVSVEYL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgttatccaatgacccctgaaggtaaaatcgccttagagaaagaattacaacat
ctgaaaactgttgaacgtccacgtattactcaagcgattgctgaagcacgtgaacatggg
gacttaaaagaaaatgcagaatatcatgctgctcgtgaacagcaaggtttctgtgaaggc
cgtatccaagatatcgaagggaaattgggtgctgcacaagtcatcgatgttaaagactta
gaacaaaacggtcgtgttgtattcggtgttacggtaacgattgaaaaccttgatactgaa
gaacgcaagacttataagattgttggtgatgatgaagctgattttaaaatcaataaaatt
tcagtaaattcgccaattgcacgtggccttttgggtaaaaatgaaggtgatgaagtaaaa
attaccactcctcaaggcgaagtggaatacgaagttgtaagtgtagaatacctctaa

DBGET integrated database retrieval system