KEGG   Acinetobacter baumannii ACICU: ACICU_02932Help
Entry
ACICU_02932       CDS       T00710                                 

Definition
(GenBank) Acetyltransferase (isoleucine patch superfamily)
  KO
K00638  
chloramphenicol O-acetyltransferase type B [EC:2.3.1.28]
Organism
abc  Acinetobacter baumannii ACICU
Brite
Enzymes [BR:abc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.28  chloramphenicol O-acetyltransferase
     ACICU_02932
Antimicrobial resistance genes [BR:abc01504]
 Gene variants
  Phenicol resistance genes
   Acetyltransferases
    ACICU_02932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3111334..3111966
Genome map
AA seq 210 aa AA seqDB search
MDTPLINTPVRHWCEFEFISKTVKNPNIHIKGNYSYYSAYWDQGFERCVVRYLHDKPSTP
DKPIDQLYIGNFVCFGAECVIMMGGNQLHRPDWISTFPFDTRSFLAAGDTIIADGCWIGS
RAMIMQGVKIGEGAVVATGAVVTKDVPPYTIVGGVPAKIIKYRFPQEQIEKLLALKIYDL
DEKQVLKMREYLQTDDIDALTAHLKKLQSE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggatactcctctaattaacacaccagtccgccattggtgtgaatttgagtttatttcc
aaaactgtgaaaaatccaaatatccatattaaagggaattactcttactactcggcatat
tgggatcaaggttttgaacgctgtgtagtgcgatatctacatgacaagccttctactcca
gacaagccaattgatcagctctatattggtaattttgtttgttttggcgctgaatgcgtg
attatgatgggtggtaaccaacttcatcggccagactggatatcgacattcccctttgac
acccgaagttttttagccgctggtgacactataattgcagatggctgctggattggaagt
cgtgcaatgattatgcaaggtgtaaaaatcggtgaaggtgctgttgttgcaactggagct
gtggtcactaaagatgtccccccttatacaattgttggtggcgtacctgcaaaaattatt
aaataccgttttcctcaggagcaaatagaaaaactacttgctttaaaaatttatgattta
gatgaaaaacaagttttaaaaatgcgggaatatttacaaacggatgatatagatgcatta
acagcacatcttaaaaaattacagagcgaataa

DBGET integrated database retrieval system