KEGG   Acinetobacter baumannii ACICU: ACICU_02934Help
Entry
ACICU_02934       CDS       T00710                                 

Definition
(GenBank) predicted methylated DNA-protein cysteine methyltransferase
  KO
K07443  
methylated-DNA-protein-cysteine methyltransferase related protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3112582..3112923)
Genome map
AA seq 113 aa AA seqDB search
MSTFMDSILTTQYELHRQILEVIALIPYGKVATYGQVARMAGLPKHARLVGYVLKHLEAD
HQVPWHRVINSQGKISLSKFNEKGENIQQLKLETEGIYLLNGKVNLKQFAWQP
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgtttatggattccattttgacaactcagtatgaactacatcgacaaatttta
gaagtcatcgctttgattccatatggaaaagttgcaacttatggccaagttgctcgtatg
gcaggtttacctaaacatgccagattagttgggtatgtgcttaaacatcttgaggcagat
catcaggtcccttggcaccgtgttattaattcgcaaggtaaaattagcctaagtaagttt
aatgaaaagggcgaaaatattcagcagttaaagcttgaaacagagggaatctatttatta
aatggcaaagtaaacttaaagcaatttgcttggcagccttaa

DBGET integrated database retrieval system