KEGG   Acinetobacter baumannii ACICU: ACICU_02952Help
Entry
ACICU_02952       CDS       T00710                                 

Definition
(GenBank) Succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACICU_02952
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACICU_02952
   00640 Propanoate metabolism
    ACICU_02952
   00660 C5-Branched dibasic acid metabolism
    ACICU_02952
Enzymes [BR:abc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ACICU_02952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3135064..3136230)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKALLKEYGMPVQEGILATNADEAVAAFEQLGGKFAVMKAQVHAGGRGKAGGV
KVAKSKEDVIEFANNIIGTRLVTYQTDANGQPVNSIIVAEDVYPVERELYLGAVVDRSSR
RITFMASTEGGVEIEKVAEETPEKIIKVEVDPLVGLQPFQAREVAFALGLKDKQIGQFVK
IMTAAYQAFVENDFALFEINPLSVRENGEILCVDAKVGIDSNALYRLPKVAALRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLYGGQPANFLDVGGGATKERVI
EAFKIILADTSVQGVLINIFGGIVRCDMIAEAIIAAVQEVNVTVPVVVRLEGNNAELGAK
LLDESGLKLISANGLSDAAEKVVAAVKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtatcaagctaaagcgttattgaaagaatatggtatgccggtacaa
gaaggtatcttggcaaccaatgcagacgaagcagttgctgcatttgaacagcttggtggt
aaattcgctgtaatgaaggcgcaagttcatgctggtggtcgtggtaaggctggtggcgtt
aaagttgcaaaatctaaagaagatgttatcgaatttgcaaacaatatcattggtactcgt
cttgtaacgtatcaaacagatgcaaatggtcaaccagtaaacagcatcattgttgctgaa
gacgtatatccagttgagcgtgagctttacttgggcgcggttgtagaccgttctagccgt
cgtattactttcatggcttctacagaaggtggtgtagaaatcgagaaagttgcggaagaa
actccagaaaaaattatcaaagttgaagttgatccattagttggtttacaaccattccaa
gcacgtgaagttgcgtttgctttaggtttgaaagacaaacaaatcggtcaattcgtgaaa
atcatgacagctgcttatcaagcatttgttgaaaatgatttcgctttatttgaaattaac
ccactttcagttcgtgaaaatggcgaaattttatgtgtagatgcgaaagtaggtatcgac
tctaacgcgctttaccgtttacctaaagttgctgctttacgtgataaatctcaagagaat
gagcgtgagttaaaagcatctgaatttgatcttaactatgttgctttagaaggtaacatc
ggttgtatggttaacggtgctggtcttgcaatggcaactatggacatcattaaactttat
ggtggtcagcctgcaaacttccttgacgttggtggcggcgcaactaaagagcgtgtaatc
gaagcgttcaaaatcattcttgctgatacgtctgtacaaggtgttttaatcaacatcttc
ggtggtatcgtgcgttgtgacatgattgctgaagcaattattgcagcggttcaagaagta
aatgtaactgttccagttgttgttcgtttagaaggtaacaacgctgagttaggtgcgaaa
ttacttgatgaatctggtttgaaattaatttctgcgaacggtttgtctgatgccgcagaa
aaagttgtagctgcagttaaagcgtaa

DBGET integrated database retrieval system