KEGG   Acinetobacter baumannii ACICU: ACICU_02953Help
Entry
ACICU_02953       CDS       T00710                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACICU_02953
   00020 Citrate cycle (TCA cycle)
    ACICU_02953
   00620 Pyruvate metabolism
    ACICU_02953
   00630 Glyoxylate and dicarboxylate metabolism
    ACICU_02953
   00640 Propanoate metabolism
    ACICU_02953
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACICU_02953
   00280 Valine, leucine and isoleucine degradation
    ACICU_02953
Enzymes [BR:abc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ACICU_02953
Exosome [BR:abc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ACICU_02953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(3136378..3137811)
Genome map
AA seq 477 aa AA seqDB search
MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIHNGKPSLGGTCLNVGCIPSKALL
DSSHRYEDTVHHLADHGITTGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGT
GKLLAGKKVEFVPHEGETQILEPKYVILASGSVPVNIPVAPVDQDIIVDSTGALNFPEVP
KRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALSKEYQKILTKQGLDIRI
GAKVSGTEVNGREVTVKYTQGGEDKEQTFDKLIVCVGRKAYAEGLLAEDSGIKLTERGLV
EVNDHCATSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHP
EAAWVGLTEEQAKEKGHEVKTGQFGFAVNGRALAAGEGAGFVKFVADAKTDRLLGMHVIG
PAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGRAIHAIQRKRK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacaatttgatcttgttgtcattggcggtggtcctggtggttatgaagctgcg
attcgcgctgctcaactaggcttcaaagtcgcttgtattgaaaaacgtattcacaacggt
aagccttctttaggtggtacttgcttaaacgtaggttgtatcccttctaaagctttgctt
gattcttctcatcgttatgaagatacagtgcatcatttagctgatcacggtattacaact
ggtgaagtgaatttcgatcttgcaaaacttcttgctcgtaaagacaaaattgttgaccaa
ttaactggcggtattgatcaattgcttaaaggcaacggtatcgagtggttaaaaggtaca
ggtaaattacttgctggtaaaaaagttgagtttgttccacatgaaggtgaaactcaaatt
ttagaacctaaatacgtaatccttgcgtctggttctgtgcctgtaaatattcctgtagct
cctgtagatcaagatattattgttgattcaactggcgcattaaacttccctgaagtacct
aagcgtttaggtgtaattggtgcaggtgtaatcggtttagaacttggttcagtatggcgt
cgtcttggtgctgaagttgttgtatttgaagcaatggatgcattcttgccaatggctgat
aaagcactttctaaggaatatcaaaaaatcttgactaaacaaggtttagatatccgcatt
ggtgcgaaagtatctggtactgaagtaaacggtcgtgaagtgactgttaaatacactcaa
ggtggcgaagataaagaacaaacgtttgataagttaatcgtttgtgttggccgtaaagct
tatgctgaaggtttattagctgaagattcaggtattaaattaactgagcgtggtttagtt
gaagtaaatgatcactgtgcaacttctgtagaaggtgtatatgcgattggtgacttagta
cgcggtccaatgcttgctcataaagcaatggaagagggcgtaatggctgttgaacgtatt
catggtcatgcagctcaagtaaactatgacacaatcatttctgttatctatacacaccct
gaagcggcgtgggttggtttaactgaagagcaagctaaagaaaaaggtcatgaagtaaaa
actggtcaattcggttttgctgtaaatggtcgtgctttagctgctggtgaaggtgcaggt
tttgttaagtttgttgctgatgcaaaaactgaccgtttattaggtatgcatgtgattggg
cctgcggcatctgatatcgttcaccaaggtatgatcgcacttgaatttgtatcttctgtt
gaagatcttcagttgatgacttttggtcacccaacattctctgaagttgttcatgaagct
gcacttgctgtagatggtcgtgcaattcacgcgattcaacgtaagcgtaaataa

DBGET integrated database retrieval system