KEGG   Acinetobacter baumannii ACICU: ACICU_02961Help
Entry
ACICU_02961       CDS       T00710                                 

Definition
(GenBank) Citrate synthase
  KO
K01647  
citrate synthase [EC:2.3.3.1]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACICU_02961
   00630 Glyoxylate and dicarboxylate metabolism
    ACICU_02961
Enzymes [BR:abc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     ACICU_02961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3146775..3148049
Genome map
AA seq 424 aa AA seqDB search
MSEATGKKAVLHLDGKEIELPIYSGTLGPDVIDVKDVLASGHFTFDPGFMATASCESKIT
FIDGDKGILLHRGYPIDQLATQADYLETCYLLLNGELPTAEQKVEFDAKVRAHTMVHDQV
SRFFNGFRRDAHPMAIMVGVVGALSAFYHNNLDIEDINHREITAIRLIAKIPTLAAWSYK
YTVGQPFIYPRNDLNYAENFLHMMFATPADRDYKVNPVLARAMDRIFTLHADHEQNASTS
TVRLAGSTGANPYACISAGISALWGPAHGGANEAVLKMLDEIGSVENVAEFMEKVKRKEV
KLMGFGHRVYKNFDPRAKVMKQTCDEVLEALGINDPQLALAMELERIALNDPYFVERKLY
PNVDFYSGIILKAIGIPTEMFTVIFALARTVGWISHWLEMHSGPYKIGRPRQLYTGEVQR
DIKR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcaactggcaaaaaagccgtattacatcttgatggcaaagaaattgaatta
ccaatttacagtggcacattaggtcccgatgtaatcgacgttaaagatgtattggcctca
ggtcactttacttttgatcctggttttatggcgacagcttcatgcgagtctaaaatcaca
tttatcgatggtgacaaaggtattttattacaccgcggttacccgattgaccagttagcg
actcaagcagactaccttgaaacttgttatttattattaaatggcgagttaccaactgct
gaacaaaaagttgagttcgatgcgaaagttcgtgctcatactatggttcatgatcaagtt
agccgtttcttcaatggtttccgtcgtgatgctcaccctatggcaatcatggttggtgta
gtaggcgcattatctgctttctatcacaacaaccttgacattgaagacatcaaccaccgc
gaaattactgcgattcgtttgattgctaaaattccaacgcttgctgcttggagctacaaa
tatactgtaggtcagccattcatctatccacgtaatgacttaaattacgcggaaaacttc
ttacacatgatgtttgcaactcctgcagaccgtgactacaaagtaaaccctgttcttgct
cgtgcaatggatcgtatctttacgcttcatgctgaccacgaacaaaacgcgtctacttct
acagttcgacttgctggttctactggtgcgaacccatatgcgtgtatctctgctggtatc
tctgctctttggggtcctgcacacggtggcgcgaacgaagcagttcttaaaatgcttgat
gaaatcggtagcgttgaaaatgttgctgagttcatggaaaaagttaaacgcaaagaagtt
aaacttatgggcttcggtcaccgcgtttacaaaaacttcgatccacgtgctaaagtgatg
aagcaaacttgtgacgaagttcttgaagcattaggtatcaatgatcctcaattagcgctt
gctatggaacttgaacgtattgcattgaacgacccgtactttgttgaacgtaaactttac
cctaacgtagacttctactctggtatcatccttaaagcgattggtatcccaacagaaatg
tttactgttatcttcgctcttgcacgtacagttggctggatcagtcactggttagaaatg
cacagcggtccttacaaaattggtcgtcctcgtcagctttacactggtgaagtgcaacgt
gacatcaagcgttaa

DBGET integrated database retrieval system