KEGG   Acinetobacter baumannii ACICU: ACICU_02971Help
Entry
ACICU_02971       CDS       T00710                                 

Definition
(GenBank) Lipoate-protein ligase B
  KO
K03801  
lipoyl(octanoyl) transferase [EC:2.3.1.181]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Lipoic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    ACICU_02971
Enzymes [BR:abc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     ACICU_02971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3155746..3156399
Genome map
AA seq 217 aa AA seqDB search
MSLDKPTLIIRQWNDLQDYQSKFESMKNLTNQRDENTADELWLLQHHEVLTQGQAGKPEH
ILIPSNIPVVQTDRGGQVTWHGPGQLVAYFMFDLNRLKWNVRTLVSFAEQFMIDVLKKYN
IEAYAKPDAPGVYVDGRKIGSLGFKIRRGRSYHGLALNLDCALTGFQTINPCGYAGLEMV
RIQDLVTPYPLFEQLCQDFIEYIKGTGYFNDPEVKIE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagccttgataaacccactttgattattcgtcagtggaacgatttacaagattatcaa
agcaaattcgaatcgatgaagaacctgaccaatcaacgtgatgaaaatacagcagacgag
ctgtggttactccagcatcatgaagtactaactcaaggtcaggcaggaaaaccagaacat
attctgattccatcaaacattcctgtagtacaaactgaccgtggtggacaagtaacttgg
catggtcctggtcaactcgtcgcttactttatgtttgaccttaatcgactgaaatggaat
gtacgcacattggtcagttttgctgaacaatttatgatagatgttttaaagaaatataac
attgaagcatatgcaaaacctgatgcaccaggcgtttatgtggatggcagaaagattggt
tcattaggcttcaaaattcgccgtggacgtagttatcatggtttagccctaaacttggac
tgtgctctaactggttttcaaaccatcaacccatgtggttatgcagggctagaaatggtc
cgcatacaagatttagtgactccatatccattatttgaacaactttgtcaggactttatt
gagtatattaaaggtactgggtactttaatgacccagaagtcaaaattgaataa

DBGET integrated database retrieval system