KEGG   Acinetobacter baumannii ACICU: ACICU_02976Help
Entry
ACICU_02976       CDS       T00710                                 

Definition
(GenBank) predicted transcriptional regulator
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR PadR HTH_34 HTH_24 DUF2513 HTH_12 MarR
Motif
Other DBs
NCBI-ProteinID: ACC58288
Position
3160567..3160947
Genome map
AA seq 126 aa AA seqDB search
MKECLKYNIFQQHCPARLFFEKIADKWVLLILNILEHETQHFNLLKKNIEGISPKVLSQK
LKMLERDGFIERKIQDTSPIRVDYSLTPLGQNVAAMAYQLKEWAETNIEQVLAAQIMYDE
KILEQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatgtctaaaatataatatttttcaacaacattgccctgctcgactgtttttt
gaaaaaattgcagacaaatgggttttactcatcttaaatattcttgagcatgaaactcag
cacttcaacttacttaaaaaaaatattgaagggatttcacctaaagtcttgtctcagaag
ttaaaaatgttagagagagacggttttatcgaacgaaaaattcaggatacttcccctatt
cgtgtcgattattccctcacgccacttgggcaaaatgtagctgctatggcatatcagtta
aaagaatgggctgaaactaatattgagcaagttttagcagcccaaatcatgtatgacgaa
aaaatactagaacaagcttaa

DBGET integrated database retrieval system