KEGG   Acinetobacter baumannii ACICU: ACICU_02981Help
Entry
ACICU_02981       CDS       T00710                                 

Definition
(GenBank) Outer membrane lipoprotein-sorting protein
  KO
K03634  
outer membrane lipoprotein carrier protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3165294..3165983)
Genome map
AA seq 229 aa AA seqDB search
MLRKTMCAITLSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKA
NTKTVAQKKGLSAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQ
AVRQSLDDQVADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFG
ANKAPTLMVLQDSLGQTTYVRFKNVKVNASIPASTFNFTPPKGTDIIDQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtaaaaccatgtgtgctattacactcagcgcctcagtgcttgctcctgtaatg
agtactacagcgttcgctgcacccgtagcagcaccggagcaacaggcaattgggaacctg
gtaaatcagttatcaggcttacagcgtttgactgccgattttgaacagacaacgaaagcg
aatacaaaaactgtagcacagaaaaaaggcttaagtgctcagcatatgaaccagacattt
aaaggttcaatgaaagttgaacgtccggggaaattttattgggaaactgtaagtccctct
aagcaaactattgtaacaagtggaaaaacagtctggatttatgaccctgatctacaacag
gctgtgcgccaaagcctagatgatcaggtcgctgatacaccggctttattactttctggt
aatactaaccaaatcatgaagtcttaccgagtaactcagccagataaatctaagttatat
ttcactttattccctaaaaaagaagatggagctttccaaagcttaacgattagttttggt
gccaacaaagcacctacactcatggtattgcaagattctttaggtcaaacgacttatgtt
cgtttcaagaatgttaaagtaaatgcctcaattccggcttcaactttcaattttacgcct
ccgaaaggtaccgatattattgatcaataa

DBGET integrated database retrieval system