KEGG   Acinetobacter baumannii ACICU: ACICU_02983Help
Entry
ACICU_02983       CDS       T00710                                 

Definition
(GenBank) ribosomal protein L21
  KO
K02888  
large subunit ribosomal protein L21
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:abc00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    ACICU_02983
Ribosome [BR:abc03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    ACICU_02983
  Bacteria
    ACICU_02983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3166506..3166817)
Genome map
AA seq 103 aa AA seqDB search
MYAVIQSGGKQHRVVEGETLKVELLKAESGATITFDDVLMVVNGDNIQIGAPVVAGAKVT
AEVIGHGRHDKIRIIKMRRRKHYRKQQGHRQWFTELKITGISG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcagtaatccaaagcggtggtaaacagcaccgtgtagttgagggtgaaaccctt
aaagttgaattattgaaggctgaatctggcgcaactattacatttgatgatgtattaatg
gttgtaaacggtgacaacattcaaatcggtgctccagttgtagctggcgctaaagtaact
gcagaagtgattggtcatggtcgtcacgacaaaatccgcatcatcaaaatgcgtcgtcgt
aaacactaccgtaaacaacaaggtcaccgtcaatggttcactgagttgaaaattactggt
atttcaggctaa

DBGET integrated database retrieval system