KEGG   Acinetobacter baumannii ACICU: ACICU_02986Help
Entry
ACICU_02986       CDS       T00710                                 

Definition
(GenBank) Membrane-associated phospholipid phosphatase
  KO
K01096  
phosphatidylglycerophosphatase B [EC:3.1.3.27 3.1.3.81 3.1.3.4 3.6.1.27]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACICU_02986
Enzymes [BR:abc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     ACICU_02986
    3.1.3.27  phosphatidylglycerophosphatase
     ACICU_02986
    3.1.3.81  diacylglycerol diphosphate phosphatase
     ACICU_02986
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     ACICU_02986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3170498..3171124
Genome map
AA seq 208 aa AA seqDB search
MPYLLLCIGCVFLGLGVLGLFVPSLQSLDLLTVQTLSHHRLDYLNTITTFLARVGGMPFV
CFLSFLVCIYLAWYKKYITVIFISLGVIGSITMGWLLKWCVNRPRPPEAYHIVESYGASF
PSAHSVYASTLACLAMIMLCHKHNINSPYIVLISCLWFVCMGLSRIYAGVHFPTDVLAGW
GIGFIWIALLWLWLLQTQSRLSKKQIYF
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgccctatctattgctttgtattggttgcgtttttttaggattaggtgttcttggtctt
tttgtaccaagtcttcaatctttggacttgctcaccgttcaaacattgagtcaccatcgt
ttagattatcttaatactataaccacctttcttgcacgcgtaggcggcatgccttttgta
tgttttttatcctttctagtatgtatatatttagcatggtataaaaaatatattactgtt
attttcattagcttgggagttattggcagtatcaccatgggttggctgctcaagtggtgt
gttaaccggcctagacctcctgaggcatatcatattgttgaaagttatggtgcatcgttc
ccaagtgcacatagtgtttatgcatcaacactggcttgtctggcaatgattatgttatgc
cataagcacaacattaactctccttatattgttttgatctcctgtctttggtttgtgtgt
atggggctttcaagaatatatgcaggagttcatttcccaacagacgtactcgctggttgg
ggcattggttttatttggattgcactgctttggctctggttattacaaacacaaagtagg
ttaagtaaaaaacaaatatatttttag

DBGET integrated database retrieval system