KEGG   Acinetobacter baumannii ACICU: ACICU_02989Help
Entry
ACICU_02989       CDS       T00710                                 

Definition
(GenBank) Outer membrane protein
  KO
K18139  
outer membrane protein, multidrug efflux system
Organism
abc  Acinetobacter baumannii ACICU
Pathway
beta-Lactam resistance
Quorum sensing
Module
Multidrug resistance, efflux pump MexJK-OprM
Brite
KEGG Orthology (KO) [BR:abc00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    ACICU_02989
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    ACICU_02989
Transporters [BR:abc02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACICU_02989
Antimicrobial resistance genes [BR:abc01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    ACICU_02989
   Multidrug resistance, efflux pump MexJK-OprM [MD:M00642]
    ACICU_02989
   Multidrug resistance, efflux pump MexXY-OprM [MD:M00643]
    ACICU_02989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3175585..3177042
Genome map
AA seq 485 aa AA seqDB search
MMQKVWSISGRSIAVSALALALAACQSMRGPEPVVKTDIPQSYAYNSASGTSIAEQGYKQ
FFADPRLLEVIDLALANNRDLRTATLNIERAQQQYQITQNNQLPTIGASGSAIRQVSQSR
DPNNPYSTYQVGLGVTAYELDFWGRVRSLKDAALDSYLATQSARDSTQISLISQVAQAWL
NYSFATANLRLAEQTLKAQLDSYNLNKKRFDVGIDSEVPLRQAQISVETARNDVANYKTQ
IAQAQNLLNLLVGQPVPQNLLPTQPVKRIAQQNVFTAGLPSDLLNNRPDVKAAEYNLSAA
GANIGAAKARLFPTISLTGSAGYASTDLSDLFKSGGFVWSVGPSLDLPIFDWGTRRANVK
ISETDQKIALSDYEKSVQSAFREVNDALATRANIGERLTAQQRLVEATNRNYTLSNARFR
AGIDSYLTVLDAQRSSYAAEQGLLLLQQANLNNQIELYKTLGGGLKANTSDTVVHQPSSA
ELKKQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcaaaaagtatggtctatttcaggtcgtagcattgcggtgtctgcacttgcgctt
gctttggcagcttgtcaaagcatgcgcggcccagaaccagtcgtgaaaaccgatatacca
caaagctatgcatataacagcgcttctggtacgtctattgctgaacagggttataaacag
ttctttgctgacccgcgtttgcttgaagtgattgatttggctcttgccaataaccgtgac
ttacgtacagcaacgctcaatattgaacgtgctcaacagcaatatcagattacacagaac
aaccagcttccaacaatcggagcaagtggtagtgcaattcgtcaggtttctcaaagccgt
gatccgaataacccctactctacttatcaagtaggtttgggtgtaactgcttatgagcta
gatttctggggtcgtgttcgtagcctcaaagatgctgctttagatagttatcttgcaaca
caaagtgctcgtgattcgactcaaatcagtctgattagccaagttgctcaagcatggtta
aattattcgtttgcaacagcaaacttaagactggcagagcaaacgcttaaagcacagtta
gattcttacaatctcaacaaaaaacgttttgatgtaggtattgacagtgaagttccatta
cgtcaagcacagatttctgtagaaactgcgcgtaatgatgtagcgaactacaaaactcaa
attgctcaagcacaaaacttgttgaacttgcttgtaggccaacctgttccacaaaacttg
ttacctacacaacctgtaaaacgcattgctcaacaaaatgtgtttactgccggtttacca
agtgacttgttaaataaccgtccggatgtaaaagctgctgaatacaacttaagcgctgcg
ggtgcgaatatcggtgctgcaaaagcacgtttattcccaaccattagcttaacgggttcg
gctggttatgcatcaactgacttaagtgatctatttaagtctggtggttttgtatggtca
gttggtccaagcttagatttaccaatctttgactggggtacacgccgtgccaatgtaaaa
atttctgaaaccgatcagaaaattgcattgtctgattatgaaaaatcagttcagtcggcg
ttccgtgaagttaatgacgcgcttgcaactcgtgccaatattggtgagcgtttaacagca
caacaacgtctagtagaagcaactaaccgcaactacacactttcaaatgcccgcttccgt
gccggtattgatagttacttgactgttcttgatgcacagcgttcttcatatgcagctgaa
caaggtttgttattgcttcaacaagcaaacttaaacaaccaaatcgagttatacaaaact
ctaggtggtggtttaaaagcaaatacttcagatacagtggttcaccaaccatctagtgct
gaacttaaaaagcaataa

DBGET integrated database retrieval system