KEGG   Acinetobacter baumannii ACICU: ACICU_02991Help
Entry
ACICU_02991       CDS       T00710                                 

Definition
(GenBank) uncharacterized conserved protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3177507..3177941
Genome map
AA seq 144 aa AA seqDB search
MDNLIFQLVIFLILFSIGWAFGRHIERKHLNELLEKEQQFAHIRIDTNRFATSDQLGHFI
SSNVVISHDYFKYVLASIKNVLGGRLSSYESIVERARREAIVRLKQQAHSVGANHIMGVR
LSTTELGMQGGMVEVFAYGTAVKD
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggacaatcttatttttcagcttgttatttttctcattcttttcagtattggttgggct
tttggccgccatattgaacgaaaacatttaaatgagcttctagaaaaagagcaacaattt
gcccatatcagaattgataccaatcgttttgccacaagcgaccagttgggtcattttatt
agcagtaatgtggttatttcgcatgactattttaaatatgtactggcttctataaaaaac
gttttaggtggtcgtcttagcagttatgaaagtattgttgagcgtgctcgccgcgaggcg
attgtacgactaaaacaacaagcacatagtgtaggtgcgaaccatattatgggagttcgg
ctgagtacaaccgaactcggtatgcaaggcggaatggttgaggtttttgcttatggtaca
gcagtcaaagactag

DBGET integrated database retrieval system