KEGG   Acinetobacter baumannii ACICU: ACICU_02993Help
Entry
ACICU_02993       CDS       T00710                                 

Definition
(GenBank) Dehydrogenase with different specificities
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3178427..3179233)
Genome map
AA seq 268 aa AA seqDB search
MAKLDTLQNKVVWITGASSGLGKALAGEFALQGVQVILTSRRFEELEEVRVGLLHPDQHL
SVVADITNQQQVQEAYEQILKAKGRIDWLINNAGLSQRALIQDTTMETERAIMEVDYFSQ
VALTKTVLPTMLKQKSGRVVFVSSVAGLLGTQYRASYSAAKAAIHMWANSLRAEVSDQGV
EVSVIFPGFVKTNVSFNALNGAGQPQGHQDEAIENGLEADVFAEQSVKALMQGQEYIVVG
GTKEKLGVMVSRMSPKLLYKMIRKTKVK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacttgatactttgcaaaataaagtggtgtggattacgggagcatcttccggt
ttaggtaaagctttagctggtgagtttgctttgcaaggggttcaagtgattttaacttcg
cgtcgctttgaagagttagaagaagttcgcgttggtttactccatccggatcagcacttg
tcggtagttgcagacattaccaaccaacagcaagttcaagaagcgtatgagcagatttta
aaagccaaaggtcgaatcgactggcttattaataatgcgggtttaagtcaacgtgctttg
attcaggacaccacgatggagactgaaagagccattatggaagtcgattatttctcgcaa
gtggcattaaccaaaactgtgctgccgaccatgcttaaacaaaagtctggccgagttgta
tttgtgtcgagtgtagcagggctattaggtacgcagtatcgtgcaagttattcggctgct
aaagctgcaattcacatgtgggccaacagtttacgtgctgaagtttcagatcagggcgtt
gaagtttctgtgattttcccgggctttgtaaaaactaatgtttcatttaatgcgctaaat
ggtgcagggcaacctcaaggccaccaagatgaagcaatcgaaaatggactagaggccgat
gtttttgcagaacagtcagttaaggctttaatgcaaggacaggaatatattgtagtgggc
ggtactaaagaaaaattaggcgtgatggtttcccgtatgtcaccgaaactactctataaa
atgatccggaaaacaaaagtgaaataa

DBGET integrated database retrieval system