KEGG   Acinetobacter baumannii ACICU: ACICU_02997Help
Entry
ACICU_02997       CDS       T00710                                 

Definition
(GenBank) putative DnaJ domain protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ
Motif
Other DBs
NCBI-ProteinID: ACC58309
Position
complement(3183791..3184807)
Genome map
AA seq 338 aa AA seqDB search
MSFDLKVSLQQRSEPSAQQKKLNRLIDKIEQQKVSLSTWQNAQAEIQQYIRQKLMPVYND
LHTVLFQQLEQLWNILHSHEFSKADIQQLDEKIAQLAQMLKRSKMLSAEQVDLVKQIDNF
YQQHAAESAKKNRKAQSIKSEYEESVDQGLELEEDFERYAAEQQQARKQAKQQRQQQKRE
QAEQMAAQSLKTVYLKIAAMIHPDREQDETKKEEKTELFQQASQAYEKQDLFYLLKLQLQ
LEQNKGLGAKELSAEQLRFYKLALDAQSQQLESQIAEILDSFQLAKNVKVEHVHISDVYK
AVDADCAELKQQLKWEKERLKHMKKVSGVEMLLGHGVL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttgatctcaaagtgagcttgcagcaaaggtctgaaccatctgcacagcagaaa
aaactgaatcgcctgattgataaaatagaacagcaaaaagttagtctgagcacatggcaa
aatgcacaagctgagattcaacagtacatacgacaaaaactgatgcctgtatataatgat
ttacatacagtgctatttcagcagttagagcaactttggaatatattacatagccatgag
ttttccaaagcagacatacaacaactggatgaaaaaattgcccagcttgcacaaatgttg
aagcgctcaaaaatgttatctgctgaacaggtggatttagtgaagcagatcgataacttt
tatcagcaacatgcagcggaatcggcaaaaaagaatagaaaagctcagtcaataaaatct
gaatatgaagaaagcgttgatcaaggtttagagttagaagaagactttgaacggtatgcg
gctgagcaacaacaagcgcggaaacaagctaaacagcaaagacagcaacaaaaacgtgaa
caagctgagcaaatggcagcccagtcactcaaaacagtttatttaaaaattgccgcgatg
attcacccagaccgtgagcaagatgaaactaaaaaagaagaaaaaactgagttgttccaa
caagcaagtcaggcctatgaaaaacaggacttgttttacttactcaaactccagttacag
cttgaacagaataaagggctaggcgctaaagagttatctgctgagcagttgcggttttat
aaactggctttggatgcacaaagtcagcagcttgaaagtcaaattgctgagattttagat
tcttttcagttagccaagaatgtgaaagtagagcatgtacatattagtgatgtgtataaa
gctgtagatgctgattgtgctgagctaaagcagcagttgaagtgggaaaaggaacgttta
aagcatatgaaaaaggtaagtggggtggagatgttattggggcatggggtgctttaa

DBGET integrated database retrieval system