KEGG   Acinetobacter baumannii ACICU: ACICU_03018Help
Entry
ACICU_03018       CDS       T00710                                 

Definition
(GenBank) uncharacterized bacitracin resistance protein
  KO
K06153  
undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ACICU_03018
Enzymes [BR:abc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     ACICU_03018
Peptidoglycan biosynthesis and degradation proteins [BR:abc01011]
 Precursor biosynthesis
  Diphosphatase
   ACICU_03018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3207069..3207887)
Genome map
AA seq 272 aa AA seqDB search
MENFEVIKALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGGRVFEVVIQLGAILAVC
WLYRQKIINLIKGFFSGDVESRHFAISVLIAFFPAVIIGVLAVDFIKSVLFSPIVVAIAL
IVGALIIFWVESKQFEHKTDDATKITFKQALLVGLAQCVAMIPGTSRSGATIVGGMFAGL
SRKAATEFSFFLAMPTMLGAATFDLIKNADVLTSDNMVNIGVGFVAAFIAALLVVKALVL
FVERHTLRVFAWYRIVLGVIILIAAMFFNLSA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttgaagttataaaagcactgtttctaggctttgttgaaggcttaactgaa
tttttacctatttcgagtactggtcatttaattttatttggtcatattatcgatttccat
tcagatggtggtcgtgtctttgaagtagtgatccagttaggtgctattctggcagtgtgt
tggttatatcgtcagaaaatcattaacttaatcaaaggtttttttagtggtgatgtcgag
tcacgccattttgccattagtgtcttaattgcttttttcccggcagtgattattggcgtt
ttagctgtagattttattaaaagtgttttatttagcccaattgtagttgcgattgctctg
attgtcggcgcgcttattattttctgggttgaatctaaacaatttgaacataaaacggat
gatgcgaccaagatcacgtttaaacaggcgcttttagttggtctggctcaatgtgttgcg
atgattcctggaacctctcgttctggtgcgacaattgtaggcgggatgtttgcaggcttg
tctcgtaaagctgcaacagagttttcgtttttccttgcaatgccgaccatgctaggtgca
gcaacatttgacctaattaaaaatgctgatgtgttgacttcagacaatatggttaatatt
ggagtgggttttgttgcggcatttattgctgctttattggttgtaaaagcactcgtactc
ttcgttgagcgtcatacattacgtgtatttgcatggtatcgaattgtattaggtgtaatt
atcctaattgctgctatgttctttaacttatctgcttaa

DBGET integrated database retrieval system