KEGG   Acinetobacter baumannii ACICU: ACICU_03020Help
Entry
ACICU_03020       CDS       T00710                                 

Definition
(GenBank) Fatty acid desaturase
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3209150..3210142
Genome map
AA seq 330 aa AA seqDB search
MNAQVSVTDLFSREEIQELTEPSDAYGAWAVASTWAVIGGTFASLIMMWDYLPSWGKLLA
CMLALAVLAGRQLCLAILMHDASHKSLFKNKKINDFVGEWLCARPIWNDLQKYRVHHVRH
HAKTSTPDDPDLSLVAGFPVSKQSLTRKFLRDLTGITGLKFSLGRVLMDLDVMKWTVAND
QIWLDRSDKNFVDYAKSIAKNSTGAIATNLLLYGVLKACGQQRFYWLWPLAYLTPFPLFL
RIRSMAEHAGMQTSNTALTNTRTTRAGWIARSFVAPIHVNYHMEHHLMASVPYFKLPRMH
KILRERGHVPTPPSYFEVIHILSSKQELTN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacaggtgagtgttaccgatctatttagcagagaagaaatacaagagcttaca
gaaccttcagatgcatatggcgcttgggccgttgctagcacatgggctgttattggagga
acatttgccagcttaattatgatgtgggattacttaccgagttgggggaaattattagca
tgtatgcttgctctagctgttttagctggccgtcagttatgcctcgcaattttaatgcac
gatgcatcccataaaagtttattcaaaaataagaaaataaatgatttcgttggggagtgg
ctatgtgcccgcccaatctggaacgacctacaaaaatatcgtgtacaccatgttcgacat
cacgcaaaaacatctacaccggatgatccagatctttctttagttgcaggctttcctgtc
agtaaacaatctcttactcgtaaattcttacgcgacttaaccggtataacaggattaaag
tttagcttaggccgtgtgttgatggaccttgatgtcatgaaatggactgtagccaatgat
caaatctggttagaccgcagtgataaaaatttcgttgactatgcaaagagtattgcaaaa
aacagtacaggcgctattgcaaccaacctattactttatggtgttttaaaagcatgtggt
caacaacgtttttattggttatggcctttggcttatttgactccatttccattattttta
agaattcgttcaatggcagaacatgcaggtatgcaaaccagcaatactgctttaactaac
actcgtaccacacgtgcaggttggattgcgagaagctttgtggcccctattcatgtcaat
taccacatggaacaccatttaatggcgtctgttccatattttaaattaccgcgtatgcac
aaaatattaagagaacgtgggcatgtgcccactccaccgagctattttgaagtaattcat
atactttcatcaaaacaagagttaacaaattaa

DBGET integrated database retrieval system