KEGG   Acinetobacter baumannii ACICU: ACICU_03036Help
Entry
ACICU_03036       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3225784..3227019
Genome map
AA seq 411 aa AA seqDB search
MLDFHTAMASGGFATLSDISYGFSIETSLNWTVFLTSILKTTNLIDLIALETIDKKIKKL
FKEYVQNSSLDIFSEFNKVISELKIYSQKTNFFYFIIQGLNCDKIYSFENITLGNFNEKN
SNNISFSEKINKNIKLVIDERKRNGTFNPKDIFLKELKNTIKKYKNKTVIEISNLGDPLM
AKEKSKNDAKELINQIIFITHISKSYKFHIQVHTYEVKDRIQPLCVNYDELSTSALSDEI
IYNVDFSFSQRNNIDSLSNIGSKFKELCFPILTNSFNNDLLEKLRVSINWYSASINSESL
NESFLFCAIGMESLLTTGRDSITKVLAENTAFLIAKDDIESRKLVYNTMCNLYAKRSGIA
HGGNINIETKELKQIRYYLAMSIIKIISKIKADEINSNKDLITFLDNQKFG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcttgattttcatacagccatggcttcaggcggctttgctactttaagtgatataagt
tacggtttctcaatagaaacatctcttaattggactgtatttcttacctctatattaaaa
acaaccaatctaattgatttaatagctttggaaactatagataaaaaaataaaaaaacta
ttcaaagaatatgttcagaatagtagtttagatatattttctgagtttaataaagttatt
tcagaactgaaaatttatagtcaaaaaactaatttcttctatttcattatccaaggatta
aactgcgataaaatatattcatttgaaaatataactcttggaaattttaatgaaaaaaac
tcaaacaacatttctttctcagaaaaaataaataaaaatataaaactagtcatagatgag
cgaaaaagaaatgggacatttaatcccaaagatatatttttaaaagagctaaaaaataca
ataaaaaaatataaaaataaaacagttattgagatttctaatcttggcgacccattaatg
gccaaagaaaaaagtaaaaatgatgctaaagagttaataaatcaaattattttcatcact
catatatcaaaaagttataaattccacattcaagtacatacttatgaagttaaagataga
attcaaccattatgcgtaaattatgacgaattaagtactagcgcattaagtgatgaaatt
atttacaatgtcgattttagcttttcacaaaggaataatatagatagtctaagtaatatt
ggttctaaatttaaagaattatgctttcctatactaactaatagctttaacaatgactta
ttagagaaattgcgtgtttctataaattggtatagtgcatccattaattcggaaagttta
aatgagagctttttattctgtgctattggaatggaatcattattaactacaggtagagac
tccattacaaaagtattagctgaaaacactgcttttttaatagctaaagatgacattgaa
agtagaaaactagtttacaacactatgtgcaatttatatgcaaaacgtagtggtattgca
catggtggaaacataaatattgaaaccaaagagttaaagcaaataagatactacttagct
atgagtataataaaaataatatcaaaaataaaagccgatgaaattaactcaaataaagat
ttaattactttcctagataatcagaaatttggttaa

DBGET integrated database retrieval system