KEGG   Acinetobacter baumannii ACICU: ACICU_03044Help
Entry
ACICU_03044       CDS       T00710                                 

Definition
(GenBank) Na+/alanine symporter
  KO
K03310  
alanine or glycine:cation symporter, AGCS family
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3234542..3236017)
Genome map
AA seq 491 aa AA seqDB search
MNEQLNATLMSWVQFFNEPLWDFLVIFLLAVGIFYTVLTGAVQIRMFLQSIRVMKSSRTE
GEDEHGLTPFQAFVTGLASRVGVGNIAGVAIAIAIGGPGAVFWMWVTAVLGMSSAFIEST
LAQLFKVRDSNSKQFRGGPAYYITQGLRSKTFGVIFALALIFTYGFVFNSVQINAIANAS
SHAWGWDKANLIAHLGGVDLEISWVGLALVVMVALAIFGGIKRIAKFAEMFVPLKAGLYL
SVALYIALSNYAILPDVLKLIVTEAFHFNAAAGGFFGAAVSMAMMQGIKRGLFSNEAGMG
SAPNAAAASDVKHPVNQGLVQMLGVFVDTFIVCTSTAIIILVSGVYQDAGFVGVELTQRA
LETQVGHWGADFLAVLLFLFCYSAVLGNYAYAESNVQFINNNPKVMFIFRIFVLVMVYFG
AIGSVPLVWSMADLFMGIMATINLVAILLLTPMARTLLKDYRAQLKQGIKEPVFKINKYP
ELKKKVDSDIW
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaactcaatgccacactgatgtcgtgggtacaattttttaatgaaccttta
tgggattttctggttattttcttgctggccgtcggtattttttatacggtcttaacagga
gcagtgcaaattcgcatgttcttgcaaagtattcgtgttatgaaaagcagccgtacagaa
ggcgaagatgagcatggccttacacctttccaagcgtttgtaactggtcttgcgagccgt
gttggggtgggtaacattgctggtgtggcaattgcgatcgcaattggtggcccaggcgcc
gtgttctggatgtgggtaaccgctgtacttggtatgagctctgcttttatcgaatctact
cttgctcaactttttaaggtgagagacagtaatagcaagcaattccgcggtggtccagcc
tactatattactcaaggtttacgtagtaaaacttttggtgtgatcttcgcattagcattg
atctttacttatggttttgtatttaactcagttcaaatcaatgcaattgctaatgcatct
tcacatgcttggggttgggataaagctaatcttattgcgcatttaggtggtgttgattta
gaaatttcatgggttggtcttgctcttgttgtgatggttgcattagcaatctttggtggt
attaaacgtatcgctaaattcgcagagatgtttgttcctttaaaagcaggcctttatctc
tctgtagcgttatatattgcattaagcaactatgcgattttacctgatgttttaaaactg
attgtgactgaagctttccactttaatgctgcggcaggtggtttcttcggtgctgctgta
tcaatggcaatgatgcaagggattaagcgcgggttgttctcaaacgaagcaggtatgggt
tctgcaccaaatgcggcggctgcgtctgatgtaaaacatcctgtaaaccagggtttggta
caaatgcttggtgtattcgtagatacattcattgtatgtacaagtacagcaatcatcatt
ttagtttctggtgtttaccaagatgctggtttcgtcggggttgaattaacccaacgtgca
ctagagactcaagtggggcactggggagctgacttcttagctgttctattattcttgttc
tgttactcagctgtactaggtaactatgcttatgcagaaagtaacgtacagttcattaat
aacaacccgaaagtcatgttcatcttccgtatttttgtattggtgatggtgtatttcggt
gcaattggtagtgtgccattagtatggtcaatggcagacttgtttatgggtattatggct
accattaacttggtcgcaattttactcttaacaccaatggctcgtactttattgaaagat
taccgagcgcaattgaagcaaggtattaaagaacctgtatttaaaattaataaatatcca
gagttgaagaaaaaagtcgattcagatatttggtaa

DBGET integrated database retrieval system