KEGG   Acinetobacter baumannii ACICU: ACICU_03057Help
Entry
ACICU_03057       CDS       T00710                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:abc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:abc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3248526..3249662
Genome map
AA seq 378 aa AA seqDB search
MNHSDTLSLSLELLQQPSVTPIDHTCQTIIAERLAKVGFHIEPMRFGDVDNLWARRGTEG
PVFCFAGHTDVVPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFIAKH
PNHKGSIAFLITSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRR
GSLNAVLKVQGKQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHA
GTGATNVIPGALEVTFNFRYSTEVTAEQLKQRVHEILDKHGLQYEIVWNLSGLPFLTPVG
ELVNAAQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHD
LDPLTDIYEQILENLLAQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactcagacactctctcgcttagcttagaacttttacaacagccttctgttact
cctattgatcatacttgccaaactattattgctgagcgcttagctaaggttggcttccat
attgaacctatgcgctttggagatgtcgataatttatgggctcgacgtggaaccgaaggc
cctgtattttgttttgctggtcataccgacgtagtaccaacaggacgtttagacgcttgg
aattcagacccatttgcaccagaaattcgcgatggcaaattatatggtcgtggttcagca
gatatgaaaactgcattagctgcaatggtagttgcatctgaacgttttatagcaaaacac
ccaaaccataaaggttcaattgcttttttaattacttcagatgaagaaggtcctgctgtt
aacggtacagttaaagttatcgaaacactggaaaagcgtaatgaaaaaattacttggtgt
ttggttggggaaccatcaagtactcataaattaggtgatattgttaagaatggccgtcgt
ggttctcttaatgctgtattgaaggttcaaggcaaacaaggtcatgtagcttacccacac
ttggcacgtaatccaattcatgaagcatccccagcgttagctgagttgtgccaaacagtt
tgggacaatggcaatgagtatttccctgcaacttcattccagatttcaaatatccatgca
ggtactggcgcaaccaatgtaatccctggtgctttagaagttacttttaatttccgctat
tcaaccgaggttacagcagaacagcttaaacaacgtgttcatgaaattttagacaagcat
ggcttgcaatatgaaattgtctggaatttgtctggcttaccattcttaactccagtaggt
gaattagttaacgcagctcaaactgctattttaaatgtgactggtactgagactgagctt
tcaacaagtggtggtacatctgatgggcgcttcattgctccaacaggtgcacaagtttta
gaactcggtgttctaaacgcaactatccatcaaattaatgaacatgttgatgtacatgat
cttgatccattaactgatatttatgagcaaattttagaaaatttattagctcaataa

DBGET integrated database retrieval system