KEGG   Acinetobacter baumannii ACICU: ACICU_03057Help
Entry
ACICU_03057       CDS       T00710                                 

Definition
(GenBank) Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00300  Lysine biosynthesis
abc01100  Metabolic pathways
abc01120  Microbial metabolism in diverse environments
abc01230  Biosynthesis of amino acids
Module
abc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ACICU_03057
Enzymes [BR:abc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ACICU_03057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer DUF3859
Motif
Other DBs
NCBI-ProteinID: ACC58369
UniProt: B2HY23
Position
3248526..3249662
Genome map
AA seq 378 aa AA seqDB search
MNHSDTLSLSLELLQQPSVTPIDHTCQTIIAERLAKVGFHIEPMRFGDVDNLWARRGTEG
PVFCFAGHTDVVPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFIAKH
PNHKGSIAFLITSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRR
GSLNAVLKVQGKQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHA
GTGATNVIPGALEVTFNFRYSTEVTAEQLKQRVHEILDKHGLQYEIVWNLSGLPFLTPVG
ELVNAAQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHD
LDPLTDIYEQILENLLAQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactcagacactctctcgcttagcttagaacttttacaacagccttctgttact
cctattgatcatacttgccaaactattattgctgagcgcttagctaaggttggcttccat
attgaacctatgcgctttggagatgtcgataatttatgggctcgacgtggaaccgaaggc
cctgtattttgttttgctggtcataccgacgtagtaccaacaggacgtttagacgcttgg
aattcagacccatttgcaccagaaattcgcgatggcaaattatatggtcgtggttcagca
gatatgaaaactgcattagctgcaatggtagttgcatctgaacgttttatagcaaaacac
ccaaaccataaaggttcaattgcttttttaattacttcagatgaagaaggtcctgctgtt
aacggtacagttaaagttatcgaaacactggaaaagcgtaatgaaaaaattacttggtgt
ttggttggggaaccatcaagtactcataaattaggtgatattgttaagaatggccgtcgt
ggttctcttaatgctgtattgaaggttcaaggcaaacaaggtcatgtagcttacccacac
ttggcacgtaatccaattcatgaagcatccccagcgttagctgagttgtgccaaacagtt
tgggacaatggcaatgagtatttccctgcaacttcattccagatttcaaatatccatgca
ggtactggcgcaaccaatgtaatccctggtgctttagaagttacttttaatttccgctat
tcaaccgaggttacagcagaacagcttaaacaacgtgttcatgaaattttagacaagcat
ggcttgcaatatgaaattgtctggaatttgtctggcttaccattcttaactccagtaggt
gaattagttaacgcagctcaaactgctattttaaatgtgactggtactgagactgagctt
tcaacaagtggtggtacatctgatgggcgcttcattgctccaacaggtgcacaagtttta
gaactcggtgttctaaacgcaactatccatcaaattaatgaacatgttgatgtacatgat
cttgatccattaactgatatttatgagcaaattttagaaaatttattagctcaataa

DBGET integrated database retrieval system