KEGG   Acinetobacter baumannii ACICU: ACICU_03073Help
Entry
ACICU_03073       CDS       T00710                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abc  Acinetobacter baumannii ACICU
Brite
Enzymes [BR:abc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ACICU_03073
Secretion system [BR:abc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ACICU_03073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3268379..3269089
Genome map
AA seq 236 aa AA seqDB search
MKTKLATLMLSLAFFGSAHADVKTLEQNLKTNYPDLPVKGVYQSPVAGIYEVYTSGRIVY
TNQDAKYFFVGNLVDIKQQKNMTEERIAELGKIDVKSLPLNQAIKYVKGKGERTLYIFSD
PDCPYCQRLEQNMVGVDNVTVYVFLYPLTSLHPNAEKVSNQIWCSKNPSEAWTNYMLNRK
LPAAGKSCTSPIQKNIALGQKLNIDGTPTLFLQDGQRISGVPSDAKQIEALLQSVK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaacttgctacactcatgttgagtttggcttttttcggttctgctcatgct
gatgttaaaacacttgaacaaaatctgaagacaaattatccagacctccctgtaaaaggt
gtctatcagtcacctgtcgctggaatttatgaagtctatacaagtggccgtattgtttat
accaatcaagatgcaaaatacttttttgtaggcaatttagttgatatcaaacaacaaaaa
aatatgacagaagagcgaattgccgaattgggtaaaattgatgttaaaagtctcccatta
aatcaggcaattaaatacgtcaaaggtaaaggagagcgtactctttatattttcagtgac
cctgattgcccttactgtcagcgtctagaacaaaatatggttggggtggataacgtaacc
gtatatgtattcttatatccgctgaccagcttacatccaaatgctgaaaaggtttctaat
caaatctggtgctctaaaaacccttcagaagcatggacaaattatatgcttaaccgtaaa
ttgccagcggctggcaaaagctgtacaagtccaattcagaaaaatattgctttaggccag
aaattaaatatagatggtacacccactctgttcttacaagatggtcaaagaatctctggc
gtaccaagtgatgcaaaacagattgaagcattattacagtcagtaaaataa

DBGET integrated database retrieval system