KEGG   Acinetobacter baumannii ACICU: ACICU_03117Help
Entry
ACICU_03117       CDS       T00710                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00260  Glycine, serine and threonine metabolism
abc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abc01100  Metabolic pathways
abc01110  Biosynthesis of secondary metabolites
abc01130  Biosynthesis of antibiotics
abc01230  Biosynthesis of amino acids
Module
abc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACICU_03117
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACICU_03117
Enzymes [BR:abc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACICU_03117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ACC58429
UniProt: B2HYJ0
Position
complement(3316093..3316896)
Genome map
AA seq 267 aa AA seqDB search
MSRLATRFEKLQSQQRKALVSYVMAGDPQPQVTVPLLHKMVAAGVDVIELGLPFSDPMAD
GPVIALAAERALAAGTNTLDALNMVKEFREQDQETPVVLMGYLNPVEVIGYEKFVSYAKQ
CGVDGLLLVDLPPEESKEFGAILKQHDMDQIFLLAPTSTDQRIQHVANQASGFIYYVSLK
GVTGAATLDTSEAAARIEKIKGMTNVPVGVGFGISDAASAKAMGSVADAVIVGSAFVKSF
ATLAADEAVEQTVNKVKELRAALDELV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtcttgccacccgttttgaaaagctgcagtcccaacaacgtaaagcgcttgta
tcttatgtcatggcgggtgatccacagccacaagtaacggtgccgttacttcataaaatg
gttgcggcaggagtagacgtcattgagcttggtttaccattttcagacccgatggctgat
ggtccggtaattgcacttgctgctgaacgcgcacttgcggctgggacgaacaccttagat
gcgctgaacatggtaaaagagtttcgtgagcaggatcaggaaacacctgtagttttaatg
ggttatcttaatcctgttgaagtgattggttacgagaagtttgtttcttatgcgaaacaa
tgtggtgtagatggcttattacttgtggacttaccaccggaagagtcaaaagaatttggt
gcaatcttgaaacaacatgatatggaccagattttcttacttgcaccaacttcaactgat
caacgtattcaacacgtagcgaatcaggcaagcgggtttatctactatgtttcactcaaa
ggtgtaacaggtgcagcgactttggatacttctgaagcggctgcacgtattgaaaaaatc
aaaggtatgactaacgttccagttggcgttggtttcggaattagtgatgctgcttcagcg
aaagccatgggtagtgttgcagatgccgtgattgtaggtagtgctttcgttaaatctttt
gcaacgttggcagctgatgaagctgttgaacagacggtgaataaagtcaaggagcttcga
gcagcgctcgatgagttagtatga

DBGET integrated database retrieval system