KEGG   Acinetobacter baumannii ACICU: ACICU_03372Help
Entry
ACICU_03372       CDS       T00710                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:abc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3574998..3575627
Genome map
AA seq 209 aa AA seqDB search
MSGLLFVVSAASGTGKTSLVKALLDRVSNLHVSVSHTTRGQRPGELDGVHYHFTTKDEFL
DQVNQGGFIEYAEVFGNYYGTSQATVKQQLAQGHDVLLEIDWQGAEQVRKLFPESKQIFI
LPPTQFDLRQRLSNRGTDSVEVIEHRLSCAVEDMQHYVNFDYIIINDDFNKALHELEAVI
TANRLVLSQQAKRHQNLIQDLITPQPKQE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtctattgtttgtcgtttctgctgcatcaggaacgggcaaaacatctttggtg
aaagccctacttgaccgtgtgagcaatttacatgtttcagtttcgcatactacccgaggt
caacgaccaggtgagttagatggtgttcactatcacttcacaacaaaagatgaattttta
gaccaagtgaaccaaggtggatttatcgaatatgctgaagtatttggtaattactacggc
acttcacaagcaaccgtaaaacaacagttagctcaaggacatgatgtcttgcttgaaatt
gactggcaaggtgcagagcaagtacgcaagctgtttcctgaatctaaacagatctttatt
ttaccacctactcaattcgatttacgtcaacgtttatctaaccgtggtacagactctgtt
gaagttattgaacaccgcttaagctgtgctgttgaagacatgcagcattacgtaaatttc
gactatatcatcattaatgatgactttaataaagccctacatgagcttgaagccgtcatt
acagcaaatcgtttagtcttatctcaacaggcaaaaagacatcaaaatctaattcaagac
ttgattactccacaaccaaaacaggaataa

DBGET integrated database retrieval system