KEGG   Acinetobacter baumannii ACICU: ACICU_p0076Help
Entry
ACICU_p0076       CDS       T00710                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abc  Acinetobacter baumannii ACICU
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pACICU2:43606..44166
Genome map
AA seq 186 aa AA seqDB search
MGRNVAYTDKDGRYFIFGNLFDMKTQTDLTTTPTSSNIVEVGFPNADRLKDAIKTVKGNG
KRKLVVFSDPDCPYCQQLERNLQSIDNVTIYTFLYPLESIHPTAKTTAVSIWCSKNPGKA
FQDYMIENIKPSSKNCAHPIDRNIEFASSMNIQGTPSLIFEDGSMVPGAVGVSELERLLN
SSQKSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaaatgtggcatataccgataaagatggtagatacttcatttttggaaatttg
tttgatatgaaaacacaaacagatttaacaacgactccaacaagttcaaacatagttgaa
gttggtttcccgaatgctgatcgtttaaaagatgcaattaaaacagttaaaggcaatggg
aaaagaaagctcgtagtatttagcgatcctgattgcccatattgccaacaattagaacgt
aatttgcaatcgattgataatgtaacgatttatacattcctttatccgttagagagtatt
cacccaactgctaaaacaacagcagtatcaatttggtgttctaagaatcctggtaaagca
tttcaagattacatgattgaaaatattaagccttcatccaaaaattgcgctcacccaata
gatcgtaatattgaatttgcatcaagtatgaatattcaaggtacaccttcattaatattt
gaagacggttcaatggtgcctggagcagtgggtgtttctgaactagaacgacttctcaat
tcatctcagaaatcaaaataa

DBGET integrated database retrieval system