KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_0020Help
Entry
ABTW07_0020       CDS       T01908                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Brite
Enzymes [BR:abd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ABTW07_0020
Secretion system [BR:abd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ABTW07_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20999..21697
Genome map
AA seq 232 aa AA seqDB search
MIKKLGILALFSLTTSLSFANVDTVRENIKKQYPNLKISNIQKTEMPGLYSANLDQQIIY
LGEDGQHMFVGSIIRLKDQKNLTKDLVLGQNSIDWKQLPLKDAIKTVKGNGQHVLAVFSD
PNCPYCKQLEPELDKLKDVTIYTFIYPLKPQSIVVSRQVWCAPNQSYSWKKLIEQGVKPT
VASCTNPIDRNLELGKKLGFNGTPTLIFANGFKLVGARSAEEIQAVWKELGL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaattaggaatattggcgttatttagtttaactacaagtttgagtttcgct
aatgtagatactgttcgggaaaatattaaaaaacaatatcctaatttgaaaattagtaat
attcagaaaaccgaaatgcctggactatatagtgctaatctggaccagcaaattatttat
cttggtgaagatgggcagcacatgtttgtaggctctataattcggttaaaagaccagaag
aacttaactaaagatctggttttagggcagaactcaattgattggaaacagttgccttta
aaagatgccattaaaacagtcaaaggtaatggtcagcatgttttagcagtattttctgat
ccaaattgcccttattgtaagcagcttgaacctgaactcgacaagcttaaagatgtcact
atttacacttttatctatcctttaaaacctcagtctattgtggtttctagacaagtttgg
tgtgcaccgaatcaatcatattcatggaaaaaattaattgagcaaggtgttaaaccaacg
gttgcgagctgtacaaacccgattgaccgtaacttggaattagggaaaaaattaggtttt
aatggcacacctactctcatttttgctaacggatttaaactcgtcggagcgcgctctgcc
gaagaaattcaggcagtttggaaagagttaggtttataa

DBGET integrated database retrieval system