KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_0096Help
Entry
ABTW07_0096       CDS       T01908                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ABTW07_0096
   00052 Galactose metabolism
    ABTW07_0096
   00500 Starch and sucrose metabolism
    ABTW07_0096
   00520 Amino sugar and nucleotide sugar metabolism
    ABTW07_0096
Enzymes [BR:abd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ABTW07_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
99063..99938
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVEAGIEQIILVTHSSKA
SIENYFDRNFELETTLEQKKKFDLLAEITQIVPEHVSVVSVRQPQPLGLGHAVLCAKSVV
GQDDFAVLLPDVLVKDSSGQNDLSRMISRYNSSQAAQIMVETVPDHLVDQYGIVDVKHSP
NEGESIAMQGIVEKPAVGSAPSNLSVVGRYVLPAKIMQLLENTPKGAGNEIQLTDAIAML
QDTDTVEAYRMQGQTFDCGSKVGYLKAVLHYGIEHPKLGNDFKQLILELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagcagttttaccagtagctggtttaggtacacgttttctaccggcaagt
aagtctatcccaaaggaaatggttaccgttgttgatcgtcctgctattgagtatgtagta
cgagaagcggtagaagctggaattgaacaaattattttagttactcattcatcgaaagca
tccattgaaaattattttgatcggaattttgagttggaaaccactctagagcaaaagaaa
aaattcgatttacttgcagagattactcaaattgtgcctgagcatgtgagtgtagtaagt
gttagacaacctcagcctttaggcctagggcatgctgttttatgtgcaaagagtgttgtc
ggtcaagatgattttgctgtgctattaccagatgtattagtgaaagatagctctggacaa
aatgatctatctcgtatgatttctcgctataactcaagccaagctgctcaaatcatggtt
gaaacagtgccagaccatttagtagatcaatatgggattgtggatgtaaaacatagccca
aatgaaggtgaaagcattgctatgcagggtattgttgaaaagcctgcagtaggctctgca
ccatcaaacttatcagtggttggccgctatgtgttacctgccaagattatgcaattactt
gagaacacgccgaaaggtgcgggtaatgaaattcagttaactgatgcaattgcaatgctt
caagacacagatactgttgaagcttatcgtatgcaaggtcaaacgtttgattgtggtagt
aaggttgggtatttaaaagctgtactacactatggaattgaacaccctaagttaggaaat
gattttaaacagttaattctggaacttaaattataa

DBGET integrated database retrieval system