KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_0181Help
Entry
ABTW07_0181       CDS       T01908                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ABTW07_0181
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABTW07_0181
Enzymes [BR:abd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ABTW07_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(195675..196220)
Genome map
AA seq 181 aa AA seqDB search
MTQSVYHIPVKAISGETVDLDQYKGKVLLIVNTASKCGLTPQYEGFEKLYQAKKDQGLEI
LGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKISVAGEDKHPLYQVLTTAQPERIG
EGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVVARFAPNLTADDEQIVKAVEAELA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatctgtatatcatattccagtaaaagctatttcaggcgaaacggttgacctt
gaccaatataaagggaaagttttattaatcgtaaacacagcgtctaaatgtggtttaact
ccacaatacgaaggttttgaaaagctgtatcaagcaaagaaagatcaaggtcttgaaatc
ttaggcttccctgcaaacaactttaaagaacaagagcctggttcggatgaagaaattcaa
cagttctgctcattaaactacgatgttcatttcccacttttctctaaaatctctgtagct
ggcgaagataaacatccactttatcaagtgctaacaacagctcaaccagaacgtattgga
gaaggtcctttccgtgagcgcttagaaggtttaggtattcctactaacccggcccctgaa
gtgttatggaacttcgagaaattcctagtaaataaaaacggtgaagttgttgcgcgtttt
gctcctaacttaacagcagacgatgaacaaattgtaaaagcagttgaagcagaattagct
aaataa

DBGET integrated database retrieval system