KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_0532Help
Entry
ABTW07_0532       CDS       T01908                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ABTW07_0532
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ABTW07_0532
Enzymes [BR:abd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ABTW07_0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(590387..591406)
Genome map
AA seq 339 aa AA seqDB search
MIGALMLDIAGTELTQEDIELLQAPQVGGMILFARNIESPQQVRALTDHMRQVRPDILIA
VDQEGGRVQRLKSGFTLLPAMGRFGELYITQPQKALELAEQCGWLMATEVLAVGIDFSFA
PVLDLNAISDVIGDRGFSKNIEDIAPLAGAFMRGMKKAGMANTGKHFPGHGSVKADSHVA
AAIDSRSYDEIYNHDMQSFIKLMPELDALMPAHVIYDQVDPNPAGFSPFWIQEVLRNRLK
FNGVLFSDDLSMQAACVAGGADARIQAALAAGCDMGLVCNDRSAACTALDGITNLELPNQ
ERLERMRGRIPQIQVGETLSLGNDWQAVKTAIEEFKNSL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgattggcgcgttgatgctggacatagccggcacagaacttactcaagaagatattgaa
ctattacaagctccgcaagtcggtggcatgattttatttgcacgaaatattgaatcacca
caacaagtccgtgctttaaccgaccatatgcgccaagttcgcccagatattttgattgct
gtcgaccaagaaggtggtcgcgttcaacgtctaaaatctggctttacattattgccagcc
atgggccgttttggcgagctctatatcactcaacctcaaaaagcacttgaattagctgaa
cagtgcggctggttaatggcaactgaagttttggctgtggggatcgattttagttttgcg
ccagttttagatctgaatgcaattagcgatgtaattggtgaccgtggcttctctaaaaat
atcgaagatatcgctccacttgctggtgcatttatgcgcggtatgaaaaaagccggcatg
gcaaataccggtaagcacttccctggtcacggttcggtaaaagccgattcacatgtcgca
gccgcaatcgatagccgtagctatgacgaaatttataaccatgacatgcaaagctttatc
aagcttatgcctgagctagatgcgctcatgcctgcacatgtaatttacgatcaggttgac
ccaaatccggcaggtttctcacctttctggattcaagaagtccttcgtaatcgcttgaag
tttaatggcgtacttttctccgatgacttaagcatgcaagctgcttgtgtcgctgggggt
gcagatgcgcgtattcaagcggctctggcagcaggctgtgatatggggttagtgtgtaat
gatcgtagtgcagcatgtacagcactcgatggtattacaaacttagagctaccaaatcaa
gagcgtttagaacgtatgcgtggtcgaattccacaaatccaagttggtgaaactttatcg
cttggaaatgactggcaagctgtcaaaacagccattgaagagtttaagaattcactctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system