KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_0617Help
Entry
ABTW07_0617       CDS       T01908                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
681052..681534
Genome map
AA seq 160 aa AA seqDB search
MTVTTYIGLGSNLGDSRQILSEAIAKLKSLGEVKVSKLYQSPPMGPQDQPNYLNAVAQLK
TELLPLDLLDQLQRFEQEAGRVRLRHWGERTLDLDLLIYGNEKIQNERLTVPHVGILQRD
FVVIPLLDLDADLHINDQPLKNLELIQQPTLTVLADESWA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaccacatatattggcttaggaagtaacctaggtgactcacgccagattctg
tctgaagcgatagccaaacttaaatctcttggtgaagtgaaagtatctaaactttaccaa
agtccccctatgggtccccaagatcagccgaattatctaaatgcagtcgctcagctaaaa
accgagttacttccgcttgacttacttgaccagttacagcgttttgagcaggaagctggg
cgggtaagactccgtcattggggggagcgaactttagatcttgatctactgatttatggc
aatgaaaaaatacaaaatgagcgcttaacggtgccgcatgtaggaatattacaacgagat
tttgttgtgattcctttattagatttagatgctgatctacatattaatgatcagccactt
aaaaatttagaactcatacaacagccaacgctgactgtacttgctgatgagtcttgggct
taa

DBGET integrated database retrieval system