KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_0663Help
Entry
ABTW07_0663       CDS       T01908                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABTW07_0663
  Amino acid metabolism
   00340 Histidine metabolism
    ABTW07_0663
Enzymes [BR:abd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ABTW07_0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
731919..733220
Genome map
AA seq 433 aa AA seqDB search
MGKLMRRLSTQDQNFKQVFAELLAFETVNDPNLVQTVDQIIADVRQHGDDHVLKLTQQFD
RHPAHQFSDLELSQQQLKAAFDGLNQEIREALKLAADRIRTFHEAQKQDSWTYVDDLGNT
LGQKVTPLDRVGIYVPGGLASYPSSVLMNAVPAHVAGVPEIIMVVPAPNGELNPLVLAAA
YLAGVSRVFTIGGAQAVAALAYGTQTVPRVDKITGPGNRFVAAAKRAVFGQVGIDMIAGP
SEILVYAEGVNNAEWLAMDVLSQAEHDTVAQAIFITPDEALLEAVESAIEKHLNELPKAE
IARTSIKNRGALVLVKDRAEAVDLINQVAPEHLELCLDDAEAMSQDIRHAGAIFMGRYTP
EAIGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIMCSKDGVKTLAKTADVLAVQEN
LDAHARSARYRYQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaaattgatgcgacgtttatcgactcaagatcagaacttcaaacaggtttttgcc
gagcttttagcttttgaaaccgttaatgatcctaatttagttcaaacagtagatcaaatt
attgctgatgttcgtcagcatggtgatgatcatgttttaaaacttactcaacagttcgat
cgacatccagcgcatcaattttccgatctagaattgtctcaacaacaacttaaagctgct
tttgatggtttaaatcaagagattcgtgaagccctgaaacttgcagctgatcgtattcgt
acttttcatgaagctcaaaaacaagatagctggacttatgtggatgatttgggtaatacc
ctaggacaaaaagtgactccacttgaccgtgttggtatttatgtaccaggcggacttgca
tcttatccttcatctgtacttatgaatgcggtaccagcacatgtggctggtgtacctgaa
attattatggttgtgccagccccaaatggtgaactaaatccactcgttttagctgccgcc
tatctagcaggtgttagccgagtatttaccattggtggggcacaagctgttgctgcttta
gcttatggtactcaaactgttccacgtgttgataaaattacgggtcctggaaaccgattt
gtggcagctgctaaacgtgctgtatttggtcaggtgggtattgacatgattgctggacct
tctgaaatattagtttatgcagaaggtgtgaataatgctgaatggttagcgatggatgta
ttatctcaagctgaacatgacacagtagctcaagctattttcattactccagatgaagca
ttattagaagcagtagagtctgcaattgagaaacatttaaatgaattgcctaaagccgag
attgcgcgtacatcgattaaaaatcgtggtgcattagttttggtaaaagaccgtgctgaa
gcagttgatttaattaatcaggttgcaccagagcatttggaactatgtcttgatgatgct
gaagcgatgagccaagatattcgtcatgcaggggcaatttttatgggtcgctatacacct
gaagcaattggtgattattgtgctggcccaaaccacgtattaccgacatcaggcacagct
cgtttctcttcgccacttggtgtatatgattttcaaaagcgctctagtttgatcatgtgt
tcaaaagatggcgttaagactttggctaaaacagctgatgtacttgctgttcaagaaaat
ctcgatgcccatgcacgctcggcgcgttatcgttatcaataa

DBGET integrated database retrieval system