KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_0867Help
Entry
ABTW07_0867       CDS       T01908                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00010  Glycolysis / Gluconeogenesis
abd00030  Pentose phosphate pathway
abd00051  Fructose and mannose metabolism
abd00052  Galactose metabolism
abd00230  Purine metabolism
abd00500  Starch and sucrose metabolism
abd00520  Amino sugar and nucleotide sugar metabolism
abd00521  Streptomycin biosynthesis
abd01100  Metabolic pathways
abd01110  Biosynthesis of secondary metabolites
abd01120  Microbial metabolism in diverse environments
abd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABTW07_0867
   00030 Pentose phosphate pathway
    ABTW07_0867
   00051 Fructose and mannose metabolism
    ABTW07_0867
   00052 Galactose metabolism
    ABTW07_0867
   00500 Starch and sucrose metabolism
    ABTW07_0867
   00520 Amino sugar and nucleotide sugar metabolism
    ABTW07_0867
  Nucleotide metabolism
   00230 Purine metabolism
    ABTW07_0867
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABTW07_0867
Enzymes [BR:abd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ABTW07_0867
    5.4.2.8  phosphomannomutase
     ABTW07_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADX91303
Position
965692..967110
Genome map
AA seq 472 aa AA seqDB search
MNVRHSFPKNIFRAYDIRGKLSYLTTDVVRSIAYGLAQQYKQAEQTQLIIGYDARLTSPA
YAHLIEEILVEQGLNVTNIGCCSTPMMYYIAREFGGNGIMVTASHNPKSDNGIKWILRGE
PPSPEMIQQVGEFAQTYVPTHTISLLELSTPQFNSEFCKKYQQAIFNDIQLKRPLKVVLD
GLHGSAGHCSKLVLEKMGCEVIALRTTPNGEFPDHAPDPSHAAHLKELRKTIIEQGADIG
IALDGDGDRVVLLDEKANILTADRLLSLFAQMCLEQQPDKEIVFDVKCSLMVQRTVERLG
GKPKMIRTGSSFLRAYLSQSNGNAIFGGEYAGHYVFNDGRGFGYDDGLYAALRVMEYFTE
SSAATISDLFSNYPERCCTEDTYIGTHQSDPKHVLQDIEILSHRLGARISKIDGVRLDFD
DGFGIIRASNTGEYFTVRFDADNPLRLKEIQQKFIDMLQERYPQIAQELSEA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaagacactcatttccaaaaaatattttccgtgcttacgatattagaggcaaa
ctttcttatttaactacggacgtcgtccgttcaattgcctatggattggcacaacaatat
aaacaagcagaacaaactcaactgattattggttatgatgcgcgcctaacgagtccggct
tatgcgcatttaatcgaagagatattagtagagcagggtttaaatgttacaaatattggt
tgttgctcaaccccgatgatgtactacattgcacgggagtttggtggtaatggcataatg
gtaacagctagccataaccctaaatcagataatggtattaaatggattttaagaggtgaa
cctccatctcctgaaatgatccagcaagtaggtgaatttgcgcaaacttatgtacctact
catacaatttcattattagaattatcaactcctcaatttaattcagaattttgtaaaaaa
taccaacaagcaatctttaacgatattcaactcaagcgccctttaaaagttgtattagat
ggcctacatggatcggcagggcattgctcaaaactcgtacttgaaaaaatgggttgtgaa
gtcattgctttacgtacgactccaaatggtgagttccctgatcatgcaccagacccttca
catgctgcgcatttaaaagaactacgtaaaacgattattgaacagggggcagatattggt
attgcccttgatggtgatggcgaccgtgtcgtattgcttgatgaaaaagccaatatactt
actgctgaccgtttattgtcactatttgcacaaatgtgtctggagcagcaaccagacaaa
gaaattgtatttgatgtgaaatgctcgctcatggttcaaagaaccgtagagcgacttggt
ggtaaacccaaaatgattcgcacgggaagtagcttcctgcgcgcgtatttatcccaatca
aatggtaacgctatttttgggggcgaatacgcgggtcattatgtatttaatgatgggcgt
ggttttgggtatgatgatggtttgtacgctgcattacgtgtaatggaatatttcaccgag
tcgagtgcggcaacaatttctgatttattttctaattatcctgaaagatgctgtaccgaa
gatacttatattggcacccatcagtccgaccctaaacatgtactacaagatattgaaatt
ttaagccatcgtttgggtgctcgaattagtaaaattgatggcgtacgtcttgattttgat
gatggttttggcattattcgagcatcaaatacaggtgagtattttaccgtaagatttgac
gctgataatcctttacgtttaaaggaaatccagcaaaaatttattgatatgttgcaagag
cgttatccgcaaattgcacaagaactttctgaggcctaa

DBGET integrated database retrieval system