KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1357Help
Entry
ABTW07_1357       CDS       T01908                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ABTW07_1357
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ABTW07_1357
Enzymes [BR:abd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ABTW07_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1456438..1457454
Genome map
AA seq 338 aa AA seqDB search
MHIAALHQPSQVQLNQDGNLKHFLTIEGLSKENLTKILDTAQSFLDDNNNLINRPLLEGR
TVMNLFFENSTRTRTTFEAAAKRLSANVLNIDIARSSTSKGETLRDTLWNLEAMAADIFV
VRHSSSGAAHFIAKDVCPKVAIINAGDGRHAHPTQAMLDMLTIRRETKKPFEDLSVAIIG
DIKHSRVARSDVAALQTLGCKDIRVIAPNTLLPVGFSEYGDHVRLFNNMDEGITGCDVII
ALRIQNERIDSPALSSQSEFYRMYGLNKERLSLAKPDCIVMHPGPMNRGVEIDSSIADGE
QSVILKQVTNGIAVRMAVLALSMQGQLQEQGLIEAIAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgcagcgttgcatcaaccgagccaggttcagctcaatcaagacggaaattta
aaacattttttaacgattgagggcctttcaaaagaaaacctcactaagattttagatacc
gcgcaaagctttttagatgataataataatttaattaaccgcccgcttttagaaggtcgg
acggttatgaatctcttctttgaaaactccacccgtactcgtactacttttgaagcagca
gcaaaacgtttgtctgccaatgtattgaacattgatattgcacgttcaagcacgtcaaaa
ggtgagactttacgagatacgctttggaacctcgaagcaatggctgccgatatttttgtt
gtacgtcattcatcttcaggtgctgcacatttcattgctaaagatgtatgtccgaaagtc
gcaattattaatgccggagatggacgtcatgcccatccaacgcaagcgatgctcgatatg
ctcactattcgccgtgagacgaaaaaaccatttgaagacttgagtgttgccattattggt
gacattaaacactctcgcgttgcgcgttcagatgtagctgcacttcaaacactcggatgt
aaagatatccgtgtgattgcgccgaacaccttattaccggttggtttttcagaatatggc
gaccatgttcgtttgttcaataacatggatgaaggcattaccggttgtgatgtgattatt
gctttacgtattcaaaatgaacgtatcgattcaccagcattatcttcacaatctgaattt
tacagaatgtacggtttaaacaaagagcgccttagcttggctaaaccggactgtattgtt
atgcatccgggaccaatgaaccgtggtgtagaaattgattcgagtattgctgatggcgaa
cagtcagtgattttaaaacaggtcactaacggtattgcagttcgtatggctgtgctagcg
ttgtctatgcaagggcaactccaagaacaaggtttaattgaagcgattgcgttgtaa

DBGET integrated database retrieval system