KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1645Help
Entry
ABTW07_1645       CDS       T01908                                 

Gene name
tauD
Definition
taurine dioxygenase
Orthology
K03119  
taurine dioxygenase [EC:1.14.11.17]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Taurine and hypotaurine metabolism
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:abd00920]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:abd00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1776450..1777331
Genome map
AA seq 293 aa AA seqDB search
MNTVVANLNIEVIKPTIGAIIHNIDLNALNEQTTQQIQQALLDHQVIFFRKQQLAPQAQA
DLARSFGTLHVHPIYPSIEDVPEVMVLDSWKQDLRDNELWHTDVTFSKTPPLGCVLQAIK
IPPVGGDTLWSSNTAAFKGLPLELQRKLRGLTATHDIRKSFPLERFAHNEEEREKLLQTF
KRNPPVVHPVVRTHPVTGEPLLFVSEGFTTRINELPEQESEQLLNFLFEHATQEQFHLRW
KWQDGDVAIWDNRCTQHKALFDYGDAHRIMHRATINGDVPFYKEEQQPELAEA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagtagtagcaaacttaaatatagaagtgatcaagcctaccattggcgcaatt
attcacaatattgatttgaatgcgttaaatgaacagacaacgcaacaaatccagcaggct
ttgcttgatcatcaggtcattttttttcgaaagcaacaattagcaccacaagcacaagca
gacttggcacgtagttttggtacattgcatgtgcacccgatttatccttcaattgaagat
gtacctgaggtgatggtgctcgacagttggaaacaagatttgcgtgacaatgaactttgg
cacacagatgtgacttttagtaaaactccacctttaggttgtgtgttgcaagctattaaa
attccacctgtaggtggtgacacgttgtggtcgagcaacacagcagcttttaaaggactt
ccgcttgagttacagcgaaaactacgtggcttaactgcaacccacgatattcgtaagtct
tttccgcttgagcgttttgcccataacgaagaagaacgtgaaaagcttttgcaaaccttt
aagcgtaacccaccagtggttcatccagtggtgcgtactcatccggttacaggcgagcct
ttgttgtttgtaagtgagggctttaccactcgcattaatgagttacccgaacaagaaagt
gagcaattacttaatttcttgtttgaacatgcgacccaagagcaatttcatttacgctgg
aaatggcaagacggtgacgtcgcgatttgggataaccgttgcacacaacataaagcatta
tttgattacggagatgctcatcgaattatgcaccgtgcaactattaacggtgatgtgcca
ttttataaagaagaacaacagccagagttagcagaggcttaa

DBGET integrated database retrieval system