KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1941Help
Entry
ABTW07_1941       CDS       T01908                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABTW07_1941
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABTW07_1941
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABTW07_1941
Enzymes [BR:abd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABTW07_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2057490..2058695
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTPEFQNELADLFANY
VGRPSPLFYAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGKEIKEQTHQRFGKNPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLDTNMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSIATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREAPKLSKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccaaatgaacaaggattttttggtgagtat
ggaggtcagtttattcctccgcatttaaaagaagcaatggatgaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattagcagacctctttgcaaattat
gtcggccgtccaagtcctttattttatgcaaaacgcctttcagaacagttaggtggcgca
caaatttatttaaagcgtgaagacttaaatcatacgggtgcccataaaattaatcactgt
ttaggtgaggctctacttgctaaatatatgggcaaaaagaaagttattgccgaaacgggt
gcgggtcaacatggggttgctttagcaacagcttgtgctctagtgggtattccatgtgaa
atccacatggggcaagttgatattgaaaaagaacatccaaatgtggtcaaaatgaaaatt
ttgggcgctcatttggtgtcagtaactcgcggtacagcaaccttaaaagatgctgtagat
agcgcgtttgaagaatatttaaaagatcctaaaaactttatttatgcgattggttctgtg
gttggtccccatccatttcctaaaatggttcgagattttcaatcaattattggtaaggaa
attaaagagcagacgcatcaacgatttggtaaaaacccagattatgttgtcgcatgtgtc
ggtggcggttcaaatgcaatcggtgcctttacagcttttttaaatgattcagatgtgaaa
cttgtaggagttgaacctgctgggcatgggctagatacaaatatgcattcggcaacccta
acattaggtaaaccaagccaaattcatggtatggcatgttatgttcttgaaaatgaggct
ggtgaacctttacctgtgcattctatcgcttcaggattggactatcctggtgttgggcca
caacatagtttcttaaaagatttaggccgtgtggaatatagcattgcaactgaccaagaa
tgtttagatgcgtttatgaccttatcacgagttgaaggtattgttcctgcgcttgaaagc
tcacatgctgtcgcatgggcaatacgtgaagcgccaaaactgtcgaaagaaaccatgatc
gtggtaaatctgtcgggtcgtggcgataaagattctgattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system